Cyanistes caeruleus (blue tit): 111945773 Help Entry 111945773         CDS       T05602                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04010   MAPK signaling pathway ccae04012   ErbB signaling pathway ccae04068   FoxO signaling pathway ccae04137   Mitophagy - animal ccae04140   Autophagy - animal ccae04150   mTOR signaling pathway ccae04210   Apoptosis ccae04218   Cellular senescence ccae04370   VEGF signaling pathway ccae04371   Apelin signaling pathway ccae04540   Gap junction ccae04625   C-type lectin receptor signaling pathway ccae04810   Regulation of actin cytoskeleton ccae04910   Insulin signaling pathway ccae04912   GnRH signaling pathway ccae04914   Progesterone-mediated oocyte maturation ccae04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ccae00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111945773 (KRAS)    04012 ErbB signaling pathway     111945773 (KRAS)    04370 VEGF signaling pathway     111945773 (KRAS)    04371 Apelin signaling pathway     111945773 (KRAS)    04068 FoxO signaling pathway     111945773 (KRAS)    04150 mTOR signaling pathway     111945773 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111945773 (KRAS)    04137 Mitophagy - animal     111945773 (KRAS)   09143 Cell growth and death    04210 Apoptosis     111945773 (KRAS)    04218 Cellular senescence     111945773 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     111945773 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111945773 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111945773 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     111945773 (KRAS)    04912 GnRH signaling pathway     111945773 (KRAS)    04914 Progesterone-mediated oocyte maturation     111945773 (KRAS)    04916 Melanogenesis     111945773 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccae04131]     111945773 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ccae04031]     111945773 (KRAS) Membrane trafficking [BR:ccae04131]  Endocytosis   Macropinocytosis    Ras GTPases     111945773 (KRAS) GTP-binding proteins [BR:ccae04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111945773 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  111945773 NCBI-ProteinID:  XP_023804190 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRVKKISKEEKTPGC VKIKKCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtataaacttgtggtggttggagctggtggtgtaggcaagagcgccttgaca atacagctaatccagaatcactttgtggatgaatatgaccccacaatagaggattcctac aggaagcaagtagtaattgatggagaaacctgtctcttggatattcttgatacagcaggt caagaagagtacagtgcaatgagggaccaatatatgagaacaggggaaggcttcctgtgt gtgtttgccataaacaatacaaagtcttttgaagatattcaccattatagggaacaaata aagagagttaaagactcagaagatgtcccaatggtgctagtaggaaacaaatgtgatttg ccttccagaacagtagacacaaaacaagctcaggatttagcaagaagttatggaattcct ttcattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg cgagagatccgacagtacagagtgaaaaaaatcagcaaagaagaaaagactccagggtgc gtgaaaattaaaaaatgccttgtaatgtaa

DBGET integrated database retrieval system