KEGG   Cyanistes caeruleus (blue tit): 111945794Help
Entry
111945794         CDS       T05602                                 

Definition
(RefSeq) putative trypsin-6
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04080  Neuroactive ligand-receptor interaction
ccae05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111945794
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    111945794
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccae01002]
    111945794
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111945794
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     111945794
Peptidases and inhibitors [BR:ccae01002]
 Serine peptidases
  Family S1: chymotrypsin family
   111945794
Exosome [BR:ccae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111945794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 111945794
NCBI-ProteinID: XP_023804214
LinkDB All DBs
Position
Unknown
AA seq 96 aa AA seqDB search
MKCLLLLAFIGVAVAFPTFAEDDDDKIVGGYTCAEHSVPYQVSLNVAGSHVCGGSLISSQ
WVLSAAHCYRPRIQVQLGKHNLKLNESTQQFINSAK
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcctgctgcttctcgcctttattggggtggctgttgccttccccacctttgct
gaagatgatgatgacaagattgtgggaggctacacctgtgcagaacactctgtgccctat
caagtgtccctgaatgttgctggatctcacgtctgtggaggttccctcatcagcagccag
tgggtcctgtcggctgctcactgctacagacctcgcatccaagtgcagctggggaaacac
aacttgaaactcaatgaatccactcagcagttcatcaactctgctaaa

DBGET integrated database retrieval system