KEGG   Cajanus cajan (pigeon pea): 109787759Help
Entry
109787759         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase, cytosolic isozyme-like
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109787759
   00620 Pyruvate metabolism
    109787759
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109787759
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109787759
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109787759
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109787759
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109787759
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109787759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 109787759
NCBI-ProteinID: XP_020201916
LinkDB All DBs
Position
Unknown
AA seq 508 aa AA seqDB search
MEKVLVVGGTMGRESVKPKTKIVCTLGPSSRSVEMLEKLLKAGMNVARFNFSHGSHSYHQ
ETLDNLRTAMSNTGILCAVMLDTKGPEIRTGFLKEGKPIQIHRGQEITVTTDYSIKGDES
MISMSYKKLAHHLSPGSNVLCADGTISFTVMECDKENGLVRCRCENSAVLGERKNVNLPG
VIVDLPTLTEKDKEDILQWGVPNKIDIIALSFVRKGSDLVEVRNLLGKHAKSILLMSKVE
NQEGIANFDEILANSDAFMVARGDLGMEIPIEKIFLAQKVMIHKSNIQGKPVVTATQMLE
SMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPDIAVQTMARICSEAESFIDYG
DLFKRIMETSPTPMSPLESMASAAVRTANCINAALILVLTRGGTTSKLVAKYRPSMPILS
VVVPEITTDSFQWFCSEETPARHSLIYRGLIPVLGTGSCGASQSESTEETIEFALAYAKK
TELCKLGDSVVALHRVESATVIKILDVN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggtgctggtagtgggtggaacaatggggagagagagtgtgaagcccaaaacc
aagattgtgtgcactttgggaccatcaagtaggtcagtggagatgctagagaagcttctc
aaggcagggatgaacgtggctcgcttcaacttctctcatggttctcactcttaccaccaa
gagacccttgataatctcagaactgcaatgagcaacactggcattctatgtgctgtcatg
ttggataccaagggtccagagatccgaactgggttcttgaaagaaggaaagcccatacaa
atccatagaggtcaagagatcacagtcacaactgattacagcataaagggtgatgagagc
atgatcagtatgagctacaagaagttggcacaccatttgagtccagggagcaatgttctg
tgtgctgatgggacaatcagttttactgtcatggaatgtgacaaggagaatggcttggtt
cgatgtcggtgcgaaaattctgcagttctgggggagaggaagaatgttaaccttcctgga
gtgattgttgatcttccaaccttgacagagaaggacaaggaggacattctgcagtggggg
gttcctaacaagattgacatcattgctctctcttttgttagaaaaggttcagacctggtg
gaggtcaggaatctacttggaaagcatgcaaaaagcatacttctcatgtccaaggttgaa
aatcaagagggcattgccaattttgatgaaatactggcaaattcagatgcattcatggtg
gcaagaggtgacctgggaatggaaattccgattgagaagatctttcttgctcagaaagtt
atgatacacaagtcaaacatacaaggcaagcctgtggtgacagccacccagatgttagag
tccatgatcaaatctcctcggccgacgcgagccgaggccaccgatgttgccaatgcagtt
cttgatggcacagactgtgttatgcttagtggggaaactgctgcaggagcctatccagac
attgctgtccaaaccatggctagaatttgttccgaggcagagagtttcatagactatggt
gatctattcaagagaataatggaaacatctccaactccaatgagtcctttggagagcatg
gcttcagctgcagttaggactgcaaattgtatcaatgctgctctcatcctagtgctaact
agaggtggaaccacttcaaaacttgtggcaaagtatagacccagcatgcctattctgtct
gtggtagttcctgagataacaacagattcctttcaatggttctgcagtgaggaaacccca
gcaaggcatagccttatctacagaggtctaatacctgttttgggcacaggttcttgtgga
gcttcacagagtgagtcaacagaagaaaccatagagtttgctcttgcatatgcaaagaaa
actgagctttgcaagcttggagactctgttgtagcactgcaccgagttgagtctgctact
gtgatcaagatattggatgttaactga

KEGG   Cajanus cajan (pigeon pea): 109789442Help
Entry
109789442         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase 1, cytosolic-like
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109789442
   00620 Pyruvate metabolism
    109789442
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109789442
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109789442
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109789442
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109789442
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109789442
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109789442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C RibD_C
Motif
Other DBs
NCBI-GeneID: 109789442
NCBI-ProteinID: XP_020203986
LinkDB All DBs
Position
Unknown
AA seq 526 aa AA seqDB search
MQSSPLLLEEPIRMASVLEPSKPTFFPAMTKIVGTLGPKSRSIDIISRCLDAGMSVARFD
FSWGDPEYHQETLENLRVAIKSTKKLCAIMVDTVGPELQVENKTDHPITLEVDTLVVLTP
DQNKDASSNLLPINFSGLSKAVKKGDIIFIGKYLCTGSETASVWMEVSEVDGDDVTCLVK
NTATLSGSLFTVHVSQTHIDLPTLTDKDKEVISTWGVQNNIDFLALYTRHVEDIRYAREF
LSKLGDLKQTHIYAKIENIEGLKHFDEILREADGIILARGNLGIDLPPEKVFLFQKAAIY
KCNMAGKPVVVTRVVDSMTDNLRPTRAEATDVANAVLDGSDAILLGAETLRGLYPVETIS
IVGKICAEAEKVHNQDLYFKKAVKYVGEPMSHLESIASSAVRAAIKVKASVIICFTSSGR
AARLIAKYRPTMPVISVVVPQLKTNQLRWTFTGAFEARQSLIVRGLFPMLADPRHPAGSK
SGTNESILKVALDHGKAFGIVKPHDRVVVCQKVGDSSVVKIIELED
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccagccctttgcttcttgaggaacccattaggatggcatctgtcctcgagcca
tccaagcctactttctttccagctatgacaaaaattgttggcacacttggtccaaagtcg
cgatcaattgatataatttcccgttgcctggatgcaggaatgtctgtggcaaggtttgac
ttctcatggggtgatccagaataccatcaagagacattggaaaatttgagagttgctatc
aaaagtaccaagaaactttgtgcgattatggtagatactgtgggtccagaattacaggtt
gagaataagactgatcatccaatcacccttgaagtagacacattagttgtcttaactcca
gatcagaacaaggatgcaagttcaaatctcttaccaataaattttagtgggttatcaaag
gctgtgaagaagggtgatattatttttatcggcaaatacctgtgtacaggaagtgaaaca
gcttctgtatggatggaggtcagtgaggtggatggtgatgatgtcacttgtcttgtaaaa
aacactgctacactctctggatcgttgtttactgtacatgtctctcagactcatattgat
cttcctactcttacagataaggataaagaggtaataagcacatggggtgttcagaacaat
atagacttcctcgcattatatacccgtcacgttgaagatattcgctatgcacgtgaattt
ctctctaaactcggggaccttaagcagacacatatttatgcaaagattgaaaatatagag
ggacttaaacattttgatgagatattgagagaagcagatggtatcatccttgctcgtgga
aatttagggatagatctcccacccgagaaggtgtttttattccaaaaagctgctatttac
aagtgcaacatggctggaaagccagttgttgtcacacgtgttgtggactctatgactgac
aatctaagacctactcgtgctgaagcaaccgatgttgcaaatgcagtgttggatggcagt
gatgcaattctccttggggcagagaccctgcggggactataccctgtagagaccatttcc
atagttggaaaaatatgtgccgaggcagagaaagttcataatcaagatttgtattttaag
aaggctgtcaaatatgtgggagagccaatgagccacttggaatcaattgcttcctctgcg
gttcgagcagctatcaaggttaaggcctctgttattatttgcttcacttcatctggaaga
gctgcaagattgattgctaagtacagaccaaccatgcctgtgatatctgttgttgttcct
cagttaaagacaaatcaactccgatggacattcaccggtgcttttgaggcaaggcaatca
cttattgtgagaggtcttttccctatgctggcagatccacgacacccggcggggtctaaa
agtggaacaaatgaatcaattttgaaggttgctttagaccatggcaaggcttttggcatc
gtaaagccacatgaccgagttgttgtttgccagaaagtgggtgactcgtcagttgtgaag
attattgagctcgaagattga

KEGG   Cajanus cajan (pigeon pea): 109795043Help
Entry
109795043         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase isozyme A, chloroplastic-like
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109795043
   00620 Pyruvate metabolism
    109795043
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109795043
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109795043
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109795043
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109795043
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109795043
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109795043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 109795043
NCBI-ProteinID: XP_020210038
LinkDB All DBs
Position
2
AA seq 583 aa AA seqDB search
MVLKSMVASASDLSVVSVAGNPPLHFNNRVFGGGQVTSLGFRFNREKWKGNERFNLKVRA
AVEVGVEGSNKGEALEGAFGLDVVSEGDLTVKGFAGLRKTKLVCTIGPACSSLEDLEHLA
LGGMSVARLNMCHGTREWHRDVIRKIKKLNEEKGFSVSLMIDTEGSQVHVVDHGAPSSVK
VEEGSIWQFTAEHFEGSRPFTVQTNNRGFSEGIEVGDELVIDGGMACFEVTEKTGNDLHC
KCIDAGLFLPGAKFSFWREGKLVRGKNKLPTLSTKDWADIDFGIAEGVDFFALSFVNHAD
SVKDLKKYLSTKSTKSIKVLAKIESLESLHKLEEIVRASDGIMVARGDLGVEIPLEQIPT
VQEDIIYVCRQLNKPVIVASQLLESMVEYPTPTRAEVADVSEAVRQYADALMLSGESAIG
SYGRKALAVLDMTSSRMESWSREENRQSLLNHHQLGASLPECITEQICNCAVDMANNLGV
DAIFVYTKHGHMASLLSRNRPNPPIFAFTNDESTRMALNLQWGVVPLLVDLSDDAESNIS
KSVQLMKSKGLISQGDVVLVVSDVAPTRSTPTAFQSIQVKTVI
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggttttgaagtcaatggttgcttcagcgagcgatctaagtgtggtgagtgttgcaggg
aaccctcccctccatttcaacaatcgggttttcggcggtggccaagtcactagcctcggt
tttcgtttcaacagagagaaatggaaaggaaacgaaaggttcaacttgaaggttcgtgca
gcggtggaagtgggtgtggaggggtcaaataagggagaggctttggagggtgcttttggg
ttggacgtggtttccgagggagatttaacggtgaaggggtttgcagggttgaggaagacc
aagctcgtttgcactattggccctgcttgcagctcattggaggatctcgagcacttggcc
ttgggaggcatgagcgttgccaggctcaacatgtgccatggcactagggagtggcaccgt
gacgtcattaggaagatcaagaagctgaatgaggagaaagggttctctgtttctctgatg
attgacactgagggtagtcaggttcatgttgttgatcatggagctccttcctcggttaaa
gtagaggaaggttcgatttggcaatttactgctgagcattttgagggttctcgcccattc
actgttcaaacaaacaacagaggtttttctgaaggtattgaagtgggtgatgaacttgtt
attgatggtggaatggcatgctttgaagtcactgaaaagactggtaatgatttgcattgt
aagtgcatagatgctggtcttttcctgcctggagcgaaatttagtttctggagagaggga
aagcttgtaagggggaaaaacaagcttcctactctatcaactaaggattgggctgacatt
gattttggtatagctgagggagtcgatttttttgccttatcctttgtcaatcacgctgat
tctgtaaaggatctaaagaagtacctctctacgaagtcaaccaaatccattaaagttttg
gcaaagatagaaagtttagaatcccttcataaactagaggaaatagtgcgagcttctgat
ggaatcatggtggctcgaggtgacctaggggtcgaaataccacttgaacagattcctaca
gtccaagaggatataatttacgtatgcagacaactaaacaagccagtaattgttgcttct
cagctccttgagtcaatggttgagtatccaacaccaacacgcgctgaggtagcagatgtt
tctgaggcagttcggcagtatgctgatgctttgatgttgtctggtgagtctgctattgga
tcatatggacgcaaagctttggcagtcttggatatgactagcagtagaatggaatcatgg
agtcgggaggaaaacagacaaagtcttctcaaccaccatcaacttggagcatcattgccc
gaatgcatcactgagcaaatatgcaattgtgctgttgatatggccaacaaccttggtgtg
gatgccatctttgtgtacacaaagcatggacacatggcatcacttctatcgcgcaaccgc
ccgaatcctcctatctttgctttcaccaatgatgagagtactcgcatggctctgaatttg
caatggggtgttgtaccccttcttgttgatttgtcagatgatgctgaatctaacatctca
aagtctgtccaacttatgaaatctaaaggattgatcagccaaggggatgttgttctagtt
gtctcagatgttgctcccacacgctccactcctacggctttccagtcaattcaggtgaag
actgttatctaa

KEGG   Cajanus cajan (pigeon pea): 109795302Help
Entry
109795302         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase, cytosolic isozyme
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109795302
   00620 Pyruvate metabolism
    109795302
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109795302
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109795302
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109795302
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109795302
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109795302
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109795302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI DUF2188
Motif
Other DBs
NCBI-GeneID: 109795302
NCBI-ProteinID: XP_020210350
LinkDB All DBs
Position
1
AA seq 501 aa AA seqDB search
MASTVVAEKKPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLR
AAMENTGILCAVMLDTKGPEIRTGFLKYGKPIPLKQGQEITVSTDYSIKGDNKMICMSYK
KLAEDVKPGSVILCADGTISFTVLSCDKQAGLVQCRCENSAFLGERKNVNLPGVVVDLPT
LTDKDKEDILNWGVPNKIDMIALSFVRKGSDLVEVRKVLGKHAKSIMLMSKVENQEGVAN
FDEILANSDAFMVARGDLGMEIPIEKIFLAQKVMIYKCNIQGKPVVTATQMLESMIKSPR
PTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICVEAESTLDYGDVFKRIM
EHSPVPMSPLESLASSAVRTANSAKAALILVLTRGGSTAKLVAKYRPGMPILSVVVPELK
TDTFDWSCSDEAPARHSLIFRGLVPILSAASARASHEETTEEAIEFATQHAKAKGLCHNG
DSIVALHRVGTASVIKILTVK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgacggtggtggcagagaagaaacctaaaacgaagatcgtgtgcacgctggga
cctgcatcacgctccgtccctatggtcgagaagcttctgcgagcaggcatgaacgtcgct
cgcttcaacttctcccacggctcccacgaataccatcaggaaaccctcgataatctccga
gccgccatggagaacaccggtattctctgcgccgtcatgctcgacaccaaggggcctgag
attcggactgggtttctcaaatatggtaagcctatcccactgaaacaaggtcaggaaata
accgtttccactgactatagcataaagggtgataacaagatgatttgtatgagctacaaa
aagctggctgaggatgtgaagcccgggagtgtcatactctgcgcggatggcaccatatcg
tttacagttttatcgtgtgacaaacaagcaggtttggttcaatgccgatgtgagaactct
gcttttcttggtgagaggaagaatgttaacctgcctggagtggttgtggatctcccaacc
ttgacagacaaagacaaggaagatatcttgaactggggagttcccaataagattgacatg
attgctctttcttttgttagaaaaggttctgacctggtggaagtcaggaaagttctggga
aaacatgctaagagcattatgctcatgtctaaggttgaaaaccaagaaggggttgcaaat
tttgatgaaattcttgcaaattcagatgcatttatggtggcacgtggtgaccttggaatg
gaaattccaatagagaagatatttctcgcacagaaagtgatgatttataagtgcaatatc
caaggaaaacctgttgttactgcaacccagatgttggagtcaatgatcaaatctcccagg
ccaacaagggctgaagctactgatgttgccaatgcagttctggatggtacagactgtgtg
atgcttagtggtgaaacagctgctggagcttatccagaacttgctgttcgaacaatggct
aaaatatgtgttgaagctgagagcacccttgactatggagatgtgtttaaaaggattatg
gagcactcaccagttccaatgagcccattggagagtctagcttcttctgctgtaagaact
gccaactctgctaaagcggctcttatattggttttaactagaggagggagtactgcaaaa
ttggtggctaagtacaggccaggcatgccaattctttctgtagttgttcctgagctcaag
actgatacctttgactggtcatgcagtgatgaggctcctgcgagacacagcctgatattc
cgtgggttggttccaatattgagtgcagcttctgctagagcttctcatgaagaaacaacg
gaagaagcaatagaatttgccacgcaacatgccaaggcaaagggtctctgccataatggg
gattctatcgtcgcactgcatcgtgtgggcactgcatctgtcatcaagatcttgactgtg
aaatga

KEGG   Cajanus cajan (pigeon pea): 109795505Help
Entry
109795505         CDS       T04868                                 

Definition
(RefSeq) plastidial pyruvate kinase 2
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109795505
   00620 Pyruvate metabolism
    109795505
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109795505
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109795505
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109795505
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109795505
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109795505
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109795505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C Cellulase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 109795505
NCBI-ProteinID: XP_020210624
LinkDB All DBs
Position
2
AA seq 575 aa AA seqDB search
MSQVVATRSIHTSLTRPTSGSAHHRAQTLLKPPTFASKVLPLQRNSPSKVCSRSCLVNAR
KSAPTEVVPVSPEDDSKIEEELQHLRGIQQLSDTSVGMWSKPTFRRKTKIVCTIGPSTNT
KEMIWKLAEAGMNVARLNMSHGDHASHQKVIDLVKEYNAQSKDNVIAIMLDTKGPEVRSG
DLPQPINLTTGQEFTFTIRRGVGTADCVSVNYDDFVNDVEVGDMLLVDGGMMSLMVKSKT
EDSVKCEVVDGGELKSRRHLNVRGKSATLPSITEKDWDDIKFGVDNKVDFYAVSFVKDAQ
VVHELKNYLKSCDADIHVIVKIESADSIPNLHSIITASDGAMVARGDLGAELPIEEVPLL
QEEIISICRSMGKAVIVATNMLESMIVHPTPTRAEVSDIAIAVREGSDAVMLSGETAHGK
FPLKAVKVMHTVALRTEATIPDGQMPPNIGQVFKNHMSEMFAYHATMMSNTLGTSTVVFT
RSGFMAVLLSHYRPSGTIFAFTDQKRIQQRLALYQGVCPIYMEFSEDAEETFTRALDLLQ
KQGMVKSGEEVALVQSGRQPIWRFQSTHNIQVRTV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggtagtggccactcgatccattcacacctccctcacgcgccccacttcagga
tctgcacaccacagggctcaaacgttgttgaagcctccaacttttgcttccaaagtgctc
ccacttcaaaggaacagcccctccaaggtttgttcccgaagttgcctcgtcaatgcaagg
aaatctgcacccactgaagtcgttcccgtgtcccccgaggatgattcaaagattgaggag
gagttgcagcacttgcgtggtatacagcaacttagtgacacttctgttggaatgtggtcc
aaacccacgtttaggaggaagacgaagattgtttgcaccattggtccttctaccaacacc
aaggaaatgatttggaagctggctgaggctgggatgaatgttgcccgtttgaatatgtct
cacggagaccatgcttctcatcagaaagttattgatttggttaaagagtataatgctcaa
tccaaggacaatgtaattgcaattatgcttgataccaagggtcctgaggttaggagtgga
gatttgccacaaccaatcaatttaacaactgggcaggaattcacttttaccatccggaga
ggtgttggaactgcagattgtgttagcgtgaactatgatgattttgtcaatgatgtggaa
gtgggggacatgcttcttgtcgatggtggtatgatgtctttgatggtcaagtctaagaca
gaagattctgtgaaatgtgaagttgttgatggaggagagctcaagtcaaggagacatttg
aatgttagaggaaaaagtgcaacactgccttccatcactgagaaggattgggatgacatc
aaatttggagtggataacaaagttgacttctatgctgtttcttttgttaaggatgcccaa
gtagttcatgaactgaagaattatttaaaaagctgtgatgctgatatacatgtcattgta
aaaattgaaagtgcagactctataccaaacttgcattcaattattacagcatctgatggg
gccatggttgcaagaggagatcttggtgcagagcttcctattgaagaggttccacttttg
caggaggagataatcagcatatgccgtagcatgggaaaggctgttattgtggcaacaaat
atgcttgaaagcatgattgttcacccaacaccaaccagagccgaggtatctgatattgca
attgctgttcgagaaggttctgatgccgtgatgctttctggggaaactgctcacggaaag
ttcccactaaaagccgtgaaagtaatgcacactgtagcattacggactgaagccactata
cctgatggtcaaatgccacctaatataggtcaagtattcaagaatcacatgagtgagatg
tttgcttaccatgcaaccatgatgtctaatacccttggaacctcaactgttgtcttcact
agatcaggcttcatggctgtccttttgagccactatcgaccttcaggcaccatatttgcc
tttacagatcaaaagaggatacaacagaggttggctttgtatcaaggagtctgtcctatt
tacatggaattctctgaagatgctgaagagactttcacaagagccttggatttgctgcag
aagcaaggaatggtgaaatcaggagaagaagtagcactagtacaaagtgggaggcaaccc
atatggaggttccaatccactcacaatatccaggtccgaacggtgtaa

KEGG   Cajanus cajan (pigeon pea): 109796871Help
Entry
109796871         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase 1, cytosolic-like isoform X1
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109796871
   00620 Pyruvate metabolism
    109796871
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109796871
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109796871
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109796871
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109796871
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109796871
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109796871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C RibD_C
Motif
Other DBs
NCBI-GeneID: 109796871
NCBI-ProteinID: XP_020212292
LinkDB All DBs
Position
3
AA seq 542 aa AA seqDB search
MHSNHLLIEEPIRMISILEPSKASFFPAMTKIVGTLGPKSRSVEVISACLKAGMSVARFD
FSWCNPEYHQETLNNLKDAVKTTKKLCAVMMDTVGAEMQVVNKSETSISLEADGQVVLTP
DRGQEASSEILPVNFDGLAKSMKEGDTIFIGQYLFTGSETTSVWLEVSEVTGDDVICTIK
NSATLAGSLFTLHASQVHIDLPTLTDKDKEVISTWGVKNKIDFLSLSYTRHAEDVRQARE
FLSKLGDLRETQIFAKIENVEGLTHFDEILQEADGIILSRGNLGIDLPPEKVFFFQKSAL
YKCNMAGKPAVLTRVVDTMTNNLRPTRAEATDVANAVLDGSDAILLGAETLRGLYPVETI
STVGKICAEAEKVFNQDLYFKRTVKYVGEPMTHLESIASSAVRAAIKVKASVIICFTSSG
RAARLIAKYRPTMPVISVVIPHLMTNQLKWSFSGAFVDQLPTHLWESLFTVNARQSLIVR
GLFPMLADPRHPAESTSATTESILKVALDHGKASGVIKSRDRVVVCQKLGDASVVKIIEL
ED
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcattccaatcatttgcttatcgaggaacctattcgtatgatttccatcctcgagcca
tccaaggccagtttttttcccgcaatgacgaagatcgtcggtaccctgggtcctaaatct
cgatcggtcgaggttatttctgcttgcctcaaagctggaatgtctgtggctcgtttcgac
ttctcttggtgtaaccctgaatatcaccaagagactttgaacaatttgaaggatgctgtc
aagactactaagaagctctgtgctgttatgatggatacggtgggtgcagagatgcaggtt
gttaacaaaagtgagacatcgatctcgcttgaggctgatggtcaggttgttctgactcct
gaccggggacaagaagcttcttcagagatactgcctgtcaattttgatggattggcaaag
tcaatgaaggagggagacaccatttttattggtcaatacttgttcacaggaagtgaaact
acttctgtatggctagaggtgtctgaagttacaggggatgatgtcatttgtaccataaag
aattcggcaacattggctgggtcattgttcactttgcatgcctctcaagttcatattgac
ttgcctactctcactgataaagacaaggaggttataagcacctggggagtaaaaaacaag
attgattttctatcattgtcatatactaggcatgctgaagatgtccgccaggcccgtgaa
ttcctttctaagttgggtgatctaagggaaactcaaatatttgcaaagattgaaaatgtt
gagggattgacccattttgatgaaattctacaagaagcagatggtattatcctttcccgt
gggaatttgggcattgatcttcccccagagaaggtatttttctttcaaaaatctgccctc
tacaagtgtaatatggctgggaaacctgctgtgcttacacgcgttgtggatacaatgact
aacaacttaagaccaactcgtgcagaagccactgatgttgccaatgctgttttagatgga
agtgatgcaatacttctaggtgctgagactttacgtgggttataccctgtggagactatt
tctacagttggcaaaatttgtgcagaagcagagaaagttttcaatcaagacctttatttt
aagagaactgttaaatatgttggagaacccatgacccacttggaatctattgcatcctca
gcggtgcgagcagctattaaggtgaaagcttctgttattatttgcttcacttcatctgga
agggctgcaagattgatagcaaagtataggccaacgatgccggttatctctgttgtgatc
ccccatctcatgacaaatcagctgaaatggagctttagtggagcttttgtggaccaactg
ccaactcatttgtgggaaagcctatttacagttaatgctaggcaatcacttatcgtaaga
ggcctctttcccatgctcgctgatccccgacatccagccgagtcaacaagtgccacaact
gagtctattctaaaggttgcccttgatcatggaaaagcatcaggagttataaagtcacgg
gatcgagtagttgtttgccagaaacttggtgatgcatctgtggttaagattatcgagctt
gaagattaa

KEGG   Cajanus cajan (pigeon pea): 109801384Help
Entry
109801384         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase isozyme G, chloroplastic isoform X1
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109801384
   00620 Pyruvate metabolism
    109801384
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109801384
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109801384
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109801384
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109801384
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109801384
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109801384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH Cellulase
Motif
Other DBs
NCBI-GeneID: 109801384
NCBI-ProteinID: XP_020218029
LinkDB All DBs
Position
6
AA seq 558 aa AA seqDB search
MASIHLSSAATALFQSDFSLSKSPTKRIPRLPTIARITNHTEGTQFNSSNGSPTVVNATS
PVEVQSGNYGAGHAWDNSDARRKTKIVCTIGPSTSSRDMIWNLAEAGMNVARLNMSHGDH
ASHLQTIDLVKEYNAQFQDKVISIMLDTKGPEVRSGDVPQPILLKEGQEFYFTTRRGVST
EDTVSVNYDGFVNDVEVGDVLLVDGGMMSLAVKSKTKDIVKCEVVDGGELKSRRHLNVRG
KSATLPSITDKDWEDIKFGVDNQVDFYAVSFVKDARVVHELKDYLKSHNADIHVIVKIES
ADSIPNLHSILSASDGAMVARGDLGAELPIEEVPLLQEDIIRRCHSMQKPVIVATNMLES
MINHPTPTRAEVSDIAIAVRQGADAIMLSGETAHGKFPLKAVKVMHVVALRNESSVQSGV
AYPSQLSSHESHMGGMFAFHATTMSNTLNTPIIVFTRTGSMAILLSHYRPYSTIFAFTNE
ARIKQRLALYHGVMPIYMQFSNDAEETFSRALKLLMSKGHLHEGQHVTLVQSGAQPIWRE
ESTHHIQVRKFLVYTFER
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcatccattcatctttcttccgccgctacggctctcttccaatccgatttctctctc
tccaaatcccccaccaaacgcattccacgcctacctacaatcgcccggataaccaaccac
accgagggaacgcaattcaactcctccaacggctctcccaccgtcgtcaacgcaacctct
ccggttgaggttcagtccggtaactatggcgcgggacacgcctgggataattccgacgca
cgtaggaaaactaaaatcgtttgcactataggtccttctacgagctcacgtgacatgata
tggaacctggccgaagcgggaatgaacgtggcgcgtttgaacatgtcgcatggggaccac
gcgtcgcacctgcaaaccattgatttggtgaaagaatacaatgctcaatttcaggataag
gtcatttccatcatgctcgacaccaagggtcctgaagttagaagtggggatgtacctcaa
ccaattttacttaaagaaggacaagaattctatttcaccactaggagaggggtcagcaca
gaagacacggttagcgtgaattatgatggttttgtgaatgatgtggaggttggagatgtg
ttgctggtcgatggaggaatgatgtctcttgctgttaagtcaaagacaaaagatattgtt
aaatgtgaggttgttgatgggggtgaattgaaatctaggcgtcatttaaatgtccgtgga
aaaagtgcaacacttccttccataacagacaaggactgggaagatatcaagtttggggtg
gacaatcaagtagacttctatgctgtctcatttgtcaaggatgctagagtggttcatgag
ttaaaagattacctcaaaagtcataatgccgatatacatgtgattgtaaaaattgaaagt
gcagattccataccaaatcttcattcgatactttcagcttcagatggggccatggttgct
cgtggggaccttggagctgaacttccaatagaggaagttccattattgcaggaggacatc
attagaagatgtcacagtatgcaaaagccagttattgtggcaacaaatatgcttgaaagc
atgattaatcatcccacaccaacaagggcagaagtctctgacattgcaattgcggtaaga
caaggtgctgatgctatcatgctctcaggagaaactgcacatggaaaatttccattgaaa
gccgttaaagttatgcatgtggtggcccttaggaatgaatccagtgttcaaagtggtgtt
gcttatccaagtcaattgagttcccatgaaagccatatgggaggaatgtttgctttccat
gcgacaacaatgtctaacactcttaatactcctattattgttttcacaagaacaggatcc
atggctattcttttgagccattataggccttactcaactatctttgcattcactaatgag
gctaggattaagcagaggttggcgctttatcatggtgttatgcccatatacatgcaattt
tcaaatgatgcagaggagactttctctagagccctcaaactactaatgagtaagggtcat
ttacacgagggacagcatgttactcttgttcaaagtggagcacaaccaatctggcgtgag
gaatccactcaccatatacaagttcgcaagtttttggtctatacatttgaaaggtga

KEGG   Cajanus cajan (pigeon pea): 109808229Help
Entry
109808229         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase 1, cytosolic
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109808229
   00620 Pyruvate metabolism
    109808229
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109808229
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109808229
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109808229
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109808229
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109808229
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109808229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-GeneID: 109808229
NCBI-ProteinID: XP_020226720
LinkDB All DBs
Position
2
AA seq 527 aa AA seqDB search
MPSSHLLLEEPIRMVSILEPSKPSFFPAMTKIVGTLGPKSRSVETISGCLKAGMSVARFD
FSWHDPEYHQETLENLKVAVKSTKKLCAVMLDTVGAEMQVVNKSEKAISLEANAQVVLTP
DQGQEASSEILPINFDGLAKAVKKGDTIFIGQYLFTGSETTSVWLEVSEVNGEDVVCIIK
NSATLAGSLFTLHASQIHIDLPTLTEKDKEVISTWGVKNKIDFLSLSYTRHAEDVRQARE
FLSKLGDISQTQIFAKIENVEGLTHFDEILQEADGIILSRGNLGIDLPPEKVFLFQKSAL
YKCNMAGKPAVLTRVVDSMTDNLRPTRAEATDVANAVLDGSDAILLGAETLRGLYPVETI
STVGRICSEAEKVFNQDLYFKRTVKYVGEPMTHLESIASSAVRAAIKVKASIIICFTSSG
RAARLIAKYRPTMPVLSVVIPRLKTNQLKWSFSGAFEARQSLIVRGLFPMLADPRHPAES
TSATNESILKVALDHGKALGVIKSHDRVVVCQKLGDASVVKIIELED
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgccttctagtcacttgcttctcgaggaacccattaggatggtctccatcctcgagcca
tccaagcctagttttttccctgcaatgacaaagattgttggtaccctgggtcctaaatct
agatccgttgaaactatttctggttgcctcaaggctggcatgtcggtggctcgttttgac
ttttcatggcatgaccctgagtatcaccaggagactttggagaatttgaaggttgctgtc
aagagtactaagaagctatgtgctgttatgctggacacggtgggtgcagagatgcaggtt
gttaacaaaagcgagaaagcaatctcacttgaggcaaatgctcaagttgttctaactcct
gatcagggacaagaagcctcttcagaaatattgcccatcaattttgatggattggcaaag
gcagtgaagaagggggacactatttttattggacaatacctgttcacaggaagtgaaact
acttctgtatggctagaggtatctgaagtcaatggggaagatgttgtttgtattataaag
aactcggctacattggctgggtcattgttcaccttgcacgcctctcaaattcatatcgat
ttgcctactctcaccgagaaagacaaggaggttataagcacctggggagttaaaaacaaa
attgattttctgtcattgtcctatactcggcatgctgaagatgttcgccaggctcgtgaa
ttcctttcaaagttgggtgatatcagccagactcaaatatttgcaaagattgaaaatgtt
gagggattgacccattttgatgagattctacaagaagctgatggtattatcctttcccgt
gggaatttgggtattgatcttccaccagagaaggtgtttttatttcaaaaatctgccctt
tacaagtgtaatatggctgggaaacctgctgtgcttacacgtgtggtggatagcatgact
gacaacttgaggccaactcgtgctgaagctactgatgttgcgaatgccgttttagatgga
agtgatgccattcttctgggtgctgagactttacgtgggttgtaccctgttgagactatt
tctactgttggcagaatttgttcagaggctgagaaagttttcaatcaagacctttatttt
aagagaacagtcaagtatgttggagaacccatgacccacttggaatctattgcatcctct
gcggtacgagctgcaattaaagtgaaggcttctattataatttgtttcacttcatcagga
agggctgcaagattgattgcaaagtatagaccaacaatgccagttctttctgttgtgatc
ccccgacttaagacaaatcagctaaagtggagctttagtggagcttttgaggcaaggcaa
tcacttatcgtgagaggtctctttcctatgcttgctgatcctcgacatcctgctgaatca
acaagtgcaacaaatgagtctattctgaaggttgcccttgatcatggaaaagcattggga
gttataaaatcacatgaccgagtagttgtttgccagaaacttggtgatgcatctgtggtg
aagattattgagcttgaagattaa

KEGG   Cajanus cajan (pigeon pea): 109808815Help
Entry
109808815         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase isozyme A, chloroplastic
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109808815
   00620 Pyruvate metabolism
    109808815
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109808815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109808815
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109808815
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109808815
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109808815
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109808815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI VitK2_biosynth DnaB_C
Motif
Other DBs
NCBI-GeneID: 109808815
NCBI-ProteinID: XP_020227558
LinkDB All DBs
Position
2
AA seq 563 aa AA seqDB search
MSLSLSLSLSHSLHLFTPPPAAIPTRLHLPPPSLSLARRFPSLRASVLVSDNNGAPAPPS
DPSSIEVDAVTEAELKENGFRSTRRTKLVCTVGPATCGFEQLEALAVGGMNVARLNMCHG
TRDWHKTVIDRVRRLNHEKGFAVAIMMDTEGSEIHMGDLGGASSAKADDGEIWTFSVRAF
DSPLPQRTINVNYEGFAEDVKVGDELLVDGGMVRFEVIQKIGPDVKCRCTDPGLLLPRAN
LTFWRNGSLVRERNAMLPTISSKDWLDIDFGIAEGVDFIAISFVKSAEVITHLKSYIAAR
SRDSDISVIAKIESIDSLKNLEEIIQAADGAMVARGDLGAQIPLEQVPSAQQRIVQLCRQ
LNKPVIVASQLLESMIEYPTPTRAEVADVSEAVRQRADALMLSGESAMGQYPEKALTVLR
SVSLRIERWWREQKRYEAMLLPSVGSYFSEKISEEICSSAAKMANNLEVDALFVYTKTGY
MASLLSRCRPDCPIFAFTTTPSVRRRLNLQWGLIPFRLSFSDDMESNLNRTFSLLKARNL
IKSGDLVIAVSDMLQSIQVMNVP
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcactctcactctcactctcactctcgcactccctccacctcttcacccctccgccc
gccgccattcccacccgcctccacctgccgcccccgagcctctcgctcgctcgccgcttc
cccagcctccgcgcctcggtgctggtgtccgacaacaacggcgcccccgccccgccctcc
gatccctcctccatcgaggtggacgccgtgacggaggcggagctgaaggagaacgggttc
cgcagcacgcggcggacgaagctggtgtgcacagtggggccggcgacgtgcgggttcgag
cagctggaggccctggccgtcggaggcatgaacgtggcccgactcaacatgtgccatggc
accagggactggcacaagaccgtcatcgaccgcgtccgccgcctcaaccacgagaagggc
ttcgccgtcgccatcatgatggacaccgaaggcagcgagattcacatgggtgacctcggt
ggcgcttcctccgccaaagccgatgacggtgagatctggaccttcagtgttagggccttc
gattcgcctctccctcaacgcaccatcaatgtcaattatgaaggcttcgctgaagatgtg
aaagtgggggatgagcttttggtggatggagggatggttaggtttgaggtcattcagaaa
attggaccggatgtcaagtgcaggtgtactgatcctggcttgttgctgcccagggccaat
ctcacattctggaggaatggtagcttagtgcgagagaggaatgctatgcttcctacaatt
tcttccaaggattggttagacattgattttggtattgctgagggtgttgattttattgca
atttcatttgtcaagtctgctgaggttattactcatcttaaaagctatattgctgcacga
tctcgtgatagtgacatttctgtcattgcaaagatagaaagtattgactcattgaagaac
ttagaggagatcattcaagcagcagatggggctatggtggcacgaggagacttgggagct
caaatacctttagaacaggttccatctgctcaacaaaggattgttcaactttgcaggcaa
ttgaacaagcctgtcattgttgcctctcagctacttgaatccatgattgagtaccctaca
cctacaagagctgaagttgcagatgtttctgaagcagttaggcaaagagctgatgctttg
atgctttctggtgaatcagccatgggccagtaccctgagaaggctttaactgttttaagg
agtgtcagtttgagaattgagagatggtggagggaacagaaacgctatgaagctatgttg
ctcccatcagttgggtcttatttttcagaaaaaatatctgaagaaatctgcagttcagct
gctaaaatggccaataatttagaggtggatgcgctttttgtgtacacaaagacagggtac
atggcatctctattgtcacgttgccgtcctgactgcccaatctttgcttttactaccact
ccatcggtgcgtaggcgtctgaatctccagtggggcttgatacctttccgcctgagcttc
tcagatgatatggagagcaatcttaatagaacattttcattgcttaaggccagaaatctg
atcaaatcaggtgaccttgtcattgctgtctcagatatgttgcagtcaatacaagtgatg
aatgttccttga

KEGG   Cajanus cajan (pigeon pea): 109812545Help
Entry
109812545         CDS       T04868                                 

Definition
(RefSeq) plastidial pyruvate kinase 2-like
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109812545
   00620 Pyruvate metabolism
    109812545
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109812545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109812545
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109812545
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109812545
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109812545
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109812545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-GeneID: 109812545
NCBI-ProteinID: XP_020232121
LinkDB All DBs
Position
Unknown
AA seq 234 aa AA seqDB search
MVARGDLGAELPIEEVPLLQEEIINLCRSMGKAVIVATNMLESMIVHPTPTRAEVSDIAI
AVREGSDAIMLSGETAHGKFPLKAVKVMQTVALRTEATIPGGQMPPNIGQVFKNHMSEMF
AYHATMMSNTLGTSTVVFTRTGFMAILLSHYRPSGSIFAFTDEKRVRQKLALYQGVCPTY
MEFCDDSEATFSRALDLLQKQGMVKEGEEVALVQSGRQPIWRFQSTHNIQVRKV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggttgccagaggagatcttggtgctgagctccctattgaagaggttccacttttgcag
gaagagattatcaacttgtgtcgtagcatgggaaaggctgttattgtggcaacaaatatg
ctagaaagcatgattgttcacccaactccaaccagagcagaggtatcagatatagcaata
gctgttcgagaaggttccgatgctataatgttgtcgggagaaacagctcatgggaagttc
ccactaaaagctgtgaaagtaatgcagacggtagcattgcggacagaagctactatacca
ggtggtcaaatgccacctaacattggtcaagtgttcaagaaccacatgagcgagatgttt
gcataccatgcaactatgatgtctaatacccttggaacctcaactgttgtcttcactaga
acgggtttcatggctatcctactgagccattatcgtccttctggctccatatttgctttt
acagatgagaagagggtgcggcagaagctcgctttgtatcaaggagtctgtcccacatac
atggaattctgtgacgattctgaagctactttctcaagagccttggatttgctgcagaag
caaggaatggtgaaggaaggagaagaagtagcacttgtacaaagtggtaggcaacccata
tggaggttccaatccacacacaatatccaggttaggaaagtgtaa

KEGG   Cajanus cajan (pigeon pea): 109813735Help
Entry
109813735         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase 1, cytosolic-like
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109813735
   00620 Pyruvate metabolism
    109813735
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109813735
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109813735
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109813735
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109813735
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109813735
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109813735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-GeneID: 109813735
NCBI-ProteinID: XP_020233571
LinkDB All DBs
Position
Unknown
AA seq 527 aa AA seqDB search
MQSSPLLLEEPIRMSSILEPSKPNFFPAMTKIVGTLGPKSRSVDVISRCLEAGMSVARFD
FSWGDPEYHQETLENLRAAIKSTKKLCAVMLDTVGPELQVVNKTEHPISLQADTLVVLTP
DQNKEATSNLLPVNFSGLSKAVKKGDTIFIGQYLFTGSETTSVWLEVSEVNGDDVTCVIK
SSATLAGSLYTLHVSQIRIDLPTLASKDKEVISTWGAQNNIDFLSLSYTRHAEDIRHARE
FLSKFGDLKQTQIFAKIENIEGLTHFDEILREADGIILSRGNLGIDLPPEKVFLFQKAAI
YKCNMAGKPAVVTRVVDTMTDNLRPTRAEATDVANAVLDGSDAIVLGAETLRGLYPVETI
STVGKICAEAEKVYNQDLYFKKAVKFVGEPMTHLESIASSAVRAAIKVKASVIICFTSSG
RAARLIAKYRPTMPVISVVIPQLKTNQLRWTFTGAFEARQSLIVRGLFPMLADPRHPAES
KSTSNESILKVALDHGKTFGIIKPHDRVVVCQKVGDSSVVKIIELDD
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccagtccgttgcttctcgaggaacccatcaggatgtcttccatcctcgagcca
tccaagcctaatttctttccagcaatgactaagattgttggcacacttgggccgaagtca
cgatcagttgatgtgatttcccgttgccttgaagcaggaatgtctgtggcaaggtttgat
ttctcatggggtgatccagaataccaccaagagacattggaaaatttaagggctgctatc
aaaagtaccaagaaactctgtgcggtcatgctagatactgtgggtccagaactacaagtt
gtcaacaaaactgagcacccaatttcccttcaggctgatacattggttgtcttaactcct
gatcagaacaaagaagctacttcaaatcttttacctgtaaattttagcgggctttcaaag
gctgtgaagaagggtgatactatttttattggtcaatacctgtttacaggaagtgaaaca
acctcagtgtggctagaggtcagtgaagttaatggtgatgatgtcacttgtgtcattaaa
agttctgctactcttgctgggtcactgtatactttacatgtctctcaaattcgtattgac
cttcctactcttgccagtaaggataaggaggtgataagcacttggggtgctcaaaacaat
atagacttcctttcattatcatacaccaggcacgctgaagatattcgccatgcccgtgag
tttctctctaaatttggtgacctcaaacagactcagatctttgcaaagattgaaaatata
gagggattgacacattttgatgagatattgcgagaagctgacggtatcatcctctcacgt
ggaaatttgggcatagatcttccacctgagaaggtgtttttattccaaaaagcggctatt
tataaatgtaacatggctggaaaacctgctgttgtcacacgtgttgtggacactatgact
gataacctaagacctactcgtgctgaagcaactgatgttgccaatgcagtgttggacggc
agtgatgcaattgttctcggggcagagactttgcggggattataccctgtagagactatt
tccaccgttggaaaaatttgtgctgaggcagagaaagtttataatcaagatttatatttc
aagaaggctgtcaaatttgtgggagagccaatgactcatttggaatcaatagcttcctct
gcggttcgggcagccatcaaggttaaggcttcagtcattatttgctttacttcatctgga
agggctgcaaggctgattgctaagtaccgaccaacgatgcctgtgatatctgttgtcatt
cctcaactaaagacaaatcaacttcgatggactttcactggagcttttgaggcaaggcaa
tcacttattgtgaggggtcttttccctatgctggcagatccccgacatcctgctgagtct
aaaagtacatcaaatgaatcaattttgaaggtagctttagatcatggcaaaacttttggt
ataataaagccacatgatcgagttgttgtttgccagaaagttggtgactcctcagttgtg
aagatcattgagcttgacgattag

KEGG   Cajanus cajan (pigeon pea): 109815295Help
Entry
109815295         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase 1, cytosolic-like
Organism
ccaj  Cajanus cajan (pigeon pea)
SSDB OrthologParalogGFIT
Motif
Pfam: PK TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 109815295
NCBI-ProteinID: XP_020235559
LinkDB All DBs
Position
Unknown
AA seq 120 aa AA seqDB search
MDAVVDQEKGLTHFDEILQEADGIILSRGNLGIDLPPEKVFFFQKSALYKCNMARKPAVL
TRVVDTITNNLRPTRAGGTDVANAILDGSDVIILLGVETLRGLYPVETIVRRDYYIGLKN
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagttgttgatcaagagaagggattgacccattttgatgaaattctacaagaa
gcagatggtattatcctttcccgtgggaatttgggcattgatcttcctccagagaaggta
tttttctttcaaaaatctgccctttacaagtgtaatatggccaggaaacctgctgtgctt
acacgcgttgtggatacaataactaacaacttaagaccaactcgtgcaggaggcacagat
gttgccaatgctattttagatggaagtgatgtaataatacttctaggggttgagacttta
cgtgggttataccctgttgagactatcgtcaggagggactattatattggtttaaaaaac
taa

KEGG   Cajanus cajan (pigeon pea): 109818531Help
Entry
109818531         CDS       T04868                                 

Definition
(RefSeq) pyruvate kinase, cytosolic isozyme
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109818531
   00620 Pyruvate metabolism
    109818531
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109818531
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109818531
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109818531
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109818531
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109818531
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109818531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 109818531
NCBI-ProteinID: XP_020239610
LinkDB All DBs
Position
Unknown
AA seq 510 aa AA seqDB search
MANIDIEGILKQLPNDGRVPKTKIVCTLGPASRSVEMIEKLLRAGMNVARFNFSHGTHEY
HQETLNNLKTAMHNTGILCAVMLDTKGPEIRTGFLKDGKPIQLKEGQEITITTDYEIKGD
PEMISMSYKKLPVHLKPGNVILCSDGTITLTVLSCDPEAGTVRCRCENTAMLGERKNVNL
PGVVVDLPTLTEKDKEDILEWGVPNNIDMIALSFVRKGSDLVNVRKVLGHHAKNIQLMSK
VENQEGVLNFDEILRETDAFMVARGDLGMEIPVEKIFLAQKMMIYKCNLVGKPVVTATQM
LESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPELAVKIMARICIEAESSLD
YGAIFKEMIRSTPLPMSPLESLASSAVRTANKAKAKLIVVLTRGGSTAKLVAKYRPAVPI
LSVVVPVLTTDSFDWTCSDETPARHSLIYRGLIPILGEGSAKATDAESTEVILEAALKSA
TEKGLCTPGDAVVALHRIGAASVIKICIVK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacatagacatcgaagggatcttgaagcagttaccgaatgacgggcgtgttccg
aagaccaagattgtgtgtactttgggtcctgcatctcgatccgtggaaatgattgagaag
cttctgagggcggggatgaacgttgctcgtttcaatttctctcatggcacccacgagtat
catcaggaaaccctcaacaatctcaagactgctatgcacaacactggaatactctgtgcc
gtcatgctcgacactaagggacctgagattcggactggttttctgaaagatggaaaacct
attcaacttaaagaaggacaagaaatcaccatcactactgattatgaaattaagggggat
ccagagatgatatcaatgagttacaagaaactgcctgtccacttgaagcctggcaatgtc
atactgtgctccgatggtacaattactctcactgtcttatcttgtgatcccgaagctggt
actgttagatgtcgttgtgaaaacactgcaatgttgggtgagagaaaaaatgttaatctt
cccggtgttgtggtggatcttcccacacttactgagaaggataaggaagatattcttgaa
tggggtgtccctaacaacattgacatgattgccctttcatttgttcgtaaaggctcagat
cttgttaatgtccggaaggttctggggcatcatgcaaagaatattcagttgatgtcaaag
gttgagaaccaggagggagtcctgaattttgatgaaatcctgcgtgagactgatgcattc
atggtggcacgtggtgatctcggaatggaaatcccagttgaaaagatttttctggcacag
aaaatgatgatatacaagtgtaatcttgttgggaagcctgtggtcactgctacccaaatg
cttgaatcgatgatcaagtctccaaggccaacccgagctgaagctactgatgtagctaat
gcagttcttgatggaacagattgtgtcatgcttagtggtgaaagtgctgctggggcttac
cctgaacttgctgtgaaaatcatggctcgtatttgtattgaagcagaatcatcccttgac
tatggtgctatcttcaaagagatgataaggtctacccctttgccaatgagtccattggaa
agtcttgcatcatctgctgtccgcacagctaacaaggctaaggcaaaactcattgttgtg
ctgacacgtggtgggtctacagccaagttggttgctaagtataggccagcggttcctatc
ttgtcagtggtggttccagttttgaccacagactcgtttgattggacctgcagtgatgag
acaccagcaaggcacagcttaatatacaggggcttgattccaatattgggcgagggatct
gcgaaagctactgatgcagaatccacagaggtgattctggaagctgctcttaagtccgca
acagaaaaggggctttgtacgcctggtgatgcagttgttgccctgcatcgtattggagct
gcctctgtcataaagatctgcatagtgaaataa

KEGG   Cajanus cajan (pigeon pea): 109818694Help
Entry
109818694         CDS       T04868                                 

Definition
(RefSeq) plastidial pyruvate kinase 2-like
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00230  Purine metabolism
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00002  Glycolysis, core module involving three-carbon compounds
ccaj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ccaj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109818694
   00620 Pyruvate metabolism
    109818694
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109818694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109818694
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109818694
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     109818694
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109818694
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109818694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI Cellulase IMPDH
Motif
Other DBs
NCBI-GeneID: 109818694
NCBI-ProteinID: XP_020239814
LinkDB All DBs
Position
Unknown
AA seq 577 aa AA seqDB search
MAQVTASRSFQTTPLCPPFGSTRDTTLILLKPPSFASKVFPFEGSTTKRFKLPLRSFQIS
ARNSASSEVVPVSPEDDPKIEEHLQHLRGVESFGENSGGMWSKPTFRRKTKIVCTIGPST
DTKEMIWKLAEAGMNVARLNMSHGDHASHQKVIDLVKQYNAQCKDNVIAIMLDTKGPEVR
SGDLPQPINLVPGQEFTFTIQRGVGTADSVSVNYDDFVSDVEVGDMLLVDGGMMSMIVKS
KTEDSVKCEVVDGGELKSRRHLNVRGKSATLPSITEKDWDDIKFGVDNGVDFYAVSFVKD
AEVVHELKNYLKSCGADIHVIVKIESADSIPNLHSIITASDGAMVARGDLGAELPIEEVP
LLQEEIINLCRSMGKAVIVATNMLESMIVHPTPTRAEVSDIAIAVREGSDAIMLSGETAH
GKFPLKAVKVMHTVALRTEATIPGGQMPPNIGQVFKNHMSEMFAYHATMMSNTLGTSTVV
FTRTGFMASLLSHFRPSGSIFAFTDEKRVRQKLALYQGVCPIYMEFCDDSEATFSRALDL
LQKQGMVKEGEEVALVQSGRQPIWRFQSTHNIQVRKV
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggtcacagcctcacgatcctttcaaaccacccctttgtgccccccattcgga
tccacacgtgacacaactctaatcctcttaaagcctccatcttttgcttccaaggtgttc
cctttcgaagggtccaccaccaaacgcttcaaactccccctcagaagcttccagatcagt
gcaagaaattccgcctcttctgaagttgtccccgtgtcgcccgaagatgatccaaagatt
gaggagcatttgcaacacttacgtggggtggagtcatttggtgagaattcgggtgggatg
tggtctaagcccacgtttaggcgcaagacgaagattgtgtgcaccattggaccttctacc
gataccaaggaaatgatttggaagttggctgaggctggcatgaatgttgctcggttgaat
atgtctcatggggaccatgcttctcaccagaaggttattgacttggttaagcaatataat
gctcaatgcaaggacaatgtgattgcaatcatgcttgacacaaagggtcctgaggttagg
agcggggatttgccacagccaatcaatttagtgcctgggcaggaattcacttttactatt
cagagaggtgttggaactgcagatagtgttagtgtgaactatgatgattttgtcagtgat
gtggaagtgggggacatgcttcttgttgatggtggtatgatgtctatgattgttaagtct
aagacagaggattctgtgaaatgtgaagttgttgatggaggagagctcaagtcaaggcga
catttgaatgttagaggaaaaagtgcaacactgccttccatcactgagaaggattgggat
gatatcaagtttggagtggataacggagttgacttctatgctgtttcctttgttaaggat
gctgaagttgtccatgaattgaagaattatttgaagagctgtggtgctgatatacatgtc
atcgtaaaaattgaaagtgcagactctataccaaacttgcattcaattatcaccgcatct
gatggggctatggttgccagaggagatcttggtgctgagctccctattgaagaggttcca
cttttgcaggaagagattatcaacttgtgtcgtagcatgggaaaggctgttattgtggca
acaaatatgctagaaagcatgattgttcacccaactccaaccagagcagaggtatcagat
atagcaatagctgttcgagaaggttctgatgctataatgttgtcgggagaaacagctcat
gggaagttcccactaaaagctgtgaaagtaatgcacacggtagcattgcggacagaagct
actataccaggtggtcaaatgccacctaacattggtcaagtgttcaagaaccacatgagc
gagatgtttgcataccatgcaactatgatgtctaatacccttggaacctcaaccgtcgtc
ttcactagaacgggtttcatggctagccttctgagccattttcgtccttctggctccata
tttgcttttacagatgagaagagggtacggcagaagctcgctttgtatcaaggagtctgt
cccatatacatggaattctgtgacgattctgaagctactttctcaagagccttggatttg
ctgcagaagcaaggaatggtgaaggaaggagaagaagtagcacttgtacaaagtggtagg
caacccatatggaggttccaatccacacacaatatccaggttaggaaagtgtaa

DBGET integrated database retrieval system