KEGG   Cajanus cajan (pigeon pea): 109789245Help
Entry
109789245         CDS       T04868                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00040  Pentose and glucuronate interconversions
ccaj00051  Fructose and mannose metabolism
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109789245
   00051 Fructose and mannose metabolism
    109789245
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109789245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NCD3G
Motif
Other DBs
NCBI-GeneID: 109789245
NCBI-ProteinID: XP_020203742
LinkDB All DBs
Position
Unknown
AA seq 364 aa AA seqDB search
MGKGGMSIDDHGEGKEENMAAWLVDINTLKIQPFKLPTLGPHDVRIRMKAVGICGSDVHY
LKTLRCAHFIVKEPMVIGHECAGIIEEVGSQVKSLVPGDRVAIEPGISCWRCDHCKQGRY
NLCPEMKFFATPPVHGSLANQIVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIG
PETNVLIMGAGPIGLVTMLSARAFGAPRTVIVDVDDHRLSVAKSLGADDIVKVSTNIQDV
DEEVVQIHKAMGAGIDVTFDCAGFDKTMSTALSATKPGGKVCLVGMGHSEMTVPLTPAAA
REVDVVGVFRYMNTWPLCLEFLRSGKIDVKPLITHRFGFSQREVEEAFETSARGGNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggggggaatgtcaattgatgatcatggagaaggcaaagaagagaatatggct
gcttggcttgtagatattaacactcttaagatccaacctttcaagcttcctactctcgga
ccccatgatgtcagaatcagaatgaaggctgttggtatctgtgggagtgatgttcactac
ctcaagacactgaggtgtgcacactttatagttaaagaaccaatggttattggtcatgag
tgtgctgggatcatagaagaagttggtagtcaggtaaagagcttggtacctggtgaccgt
gtggcgattgagcctgggattagttgttggcgatgcgaccactgcaaacagggtcgttat
aacttatgccctgagatgaagttttttgctactccaccagttcatggttccctggctaat
cagatagtgcatccagcagacctatgttttaagctgccagacaatgtgagcctggaggag
ggggcaatgtgtgagcccctaagtgttggtgttcatgcttgtaggagagctaatattgga
ccagaaacaaatgtgttgatcatgggagcaggacccataggacttgttacaatgctctca
gctcgcgcttttggggcccccaggacagtcatcgtggatgtggatgaccatcgtttatct
gttgcaaaatctcttggtgcagatgatattgttaaagtttcaacaaacattcaggatgtg
gatgaagaagttgtgcagatacataaggctatgggggctggtatagatgttacctttgat
tgtgctggttttgacaaaaccatgtctacagcactgagtgctactaagccaggtggcaaa
gtttgcctagttggaatgggtcattctgaaatgactgtcccactcaccccagctgcagca
agggaagtggatgtggttggagtttttcgctatatgaacacatggcctctttgccttgag
tttctaaggagcggcaaaatcgatgtgaaaccccttataactcacaggtttgggttttct
cagagggaagtggaagaagcctttgaaacaagtgctcgtggtggtaatgccatcaaggtc
atgttcaatctttag

DBGET integrated database retrieval system