KEGG   Cajanus cajan (pigeon pea): 109790243Help
Entry
109790243         CDS       T04868                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00410  beta-Alanine metabolism
ccaj00430  Taurine and hypotaurine metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Module
ccaj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109790243
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109790243
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109790243
   00430 Taurine and hypotaurine metabolism
    109790243
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109790243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 FtsL
Motif
Other DBs
NCBI-GeneID: 109790243
NCBI-ProteinID: XP_020204981
LinkDB All DBs
Position
1
AA seq 352 aa AA seqDB search
CGIDSLKQVCWEKFARYFEVELKEVNLRDGYYVMDPEKAVELVDENTICVAAILGSTLNG
EFEDVKRLNDLLVEKNKQTGWKTPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGH
KYGLVYAGIGWVIWRSKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLVRLG
YEGYRNVMENCRDNMIVLKEGLEKTGRFDIVSKENGVPLVAFTLKDHTHFDEFQISDLLR
RFGWIVPAYTMPPDAQHVTVLRVVIREDFSRTLAERLVADVEKVLHELDSLPARVISSTS
VTVNTEQNGKVVVAKKSALETQREITAIWKKLVLERKKLNDKMMVCVRLSFD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
tgtggaattgattctctaaaacaggtttgctgggagaaatttgccaggtactttgaggtg
gagttaaaggaagttaatttgcgtgatggatactatgtgatggaccctgaaaaggccgtg
gaattggtggatgagaacactatttgtgttgctgctatccttggttctacgctaaatgga
gagtttgaagatgtcaaacgcttgaatgatctcctggttgaaaagaataagcaaactgga
tggaagactcctattcatgtggatgcagctagtggtgggttcattgcaccatttatttat
ccagagcttgagtgggactttcggttaccgctggtgaagagcatcaatgttagtgggcac
aagtatggtctggtctatgctggaatcggttgggttatttggagaagcaaggaagacttg
cctgaggaacttatcttccatatcaactatctcggtgctgatcaacccacctttaccctt
aacttctctaaagggtctagccaagtcattgctcaatactaccaactagttcgccttggc
tatgagggatatagaaacgtgatggaaaattgtagagacaacatgatagtgctgaaagag
ggactcgagaaaacagggcggtttgacattgtgtcgaaagagaatggtgtgcctttggtg
gctttcacattgaaagaccacacccactttgatgagttccaaatctctgatctgctgagg
cgctttgggtggatagtgccagcatacaccatgcccccagatgctcaacatgtcaccgtg
ctacgtgttgtcatcagggaggacttctcaagaaccctcgcagagcgtcttgtggctgat
gtggagaaggtgctgcatgagcttgattcacttccagcaagggtgataagtagcacctct
gtcacagtcaatacagaacaaaatggcaaggtggtggttgccaagaagagtgctctagag
acacagagggaaatcactgcgatttggaagaagttagtgttggagaggaagaagctgaat
gacaagatgatggtgtgtgttagacttagctttgattga

KEGG   Cajanus cajan (pigeon pea): 109796053Help
Entry
109796053         CDS       T04868                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00410  beta-Alanine metabolism
ccaj00430  Taurine and hypotaurine metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Module
ccaj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109796053
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109796053
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109796053
   00430 Taurine and hypotaurine metabolism
    109796053
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109796053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 FtsL
Motif
Other DBs
NCBI-GeneID: 109796053
NCBI-ProteinID: XP_020211258
LinkDB All DBs
Position
1
AA seq 485 aa AA seqDB search
MDLRCRFKMPEESIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLIMASINKN
YVDMDEYPVTTELQNRCVNMIAHLFNAPLGESQAAVGVGTVGSSEAIMLAGLAFKRKWQN
RRKEEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVNLRDGYYVMDPEKAVELVDENT
ICVAAILGSTLNGEFEDVKRLNDLLVEKNKQTGWKTPIHVDAASGGFIAPFIYPELEWDF
RLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEELIFHINYLGADQPTFTLNFSKGSS
QVIAQYYQLVRLGYEGYRNVMENCRDNMIVLKEGLEKTGRFDIVSKENGVPLVAFTLKDH
THFDEFQISDLLRRFGWIVPAYTMPPDAQHVTVLRVVIREDFSRTLAERLVADVEKVLHE
LDSLPARVISSTSVTVNTEQNGKVVVAKKSALETQREITAIWKKLVLERKKLNDKMMVCV
RLSFD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcgatgcaggtttaagatgccggaggagtccataccgaaggaggcagcgtac
cagatcataaacgacgagttgatgttggacgggaatccgaggctgaacctggcgtcgttt
gtgacaacttggatggaacctgagtgtgataaactcatcatggcttccattaataagaac
tatgttgacatggacgagtaccctgtcactaccgagctacagaatcggtgtgtaaatatg
atagctcatcttttcaatgcaccattaggagagtctcaggctgcagttggtgttggcaca
gttggttcatctgaggccataatgttggctggattggcattcaaaaggaagtggcagaac
agaaggaaagaagagggaaagccttatgacaaacccaacattgtcactggagccaacgtt
caggtttgctgggagaaatttgccaggtactttgaggtggagttaaaggaagttaatttg
cgtgatggatactatgtgatggaccctgaaaaggccgtggaattggtggatgagaacact
atttgtgttgctgctatccttggttctacgctaaatggagagtttgaagatgtcaaacgc
ttgaatgatctcctggttgaaaagaataagcaaactggatggaagactcctattcatgtg
gatgcagctagtggtgggttcattgcaccatttatttatccagagcttgagtgggacttt
cggttaccactggtgaagagcatcaatgttagtgggcacaagtatggtctggtctatgct
ggaatcggttgggttatttggagaagcaaggaagacttgcctgaggaacttatcttccat
atcaactatctcggtgctgatcaacccacctttacccttaacttctctaaagggtctagc
caagtcattgctcaatactaccaactagttcgccttggctatgagggatatagaaacgtg
atggaaaattgtagagacaacatgatagtgctgaaagagggactcgagaaaacagggcgg
tttgacattgtgtcgaaagagaatggtgtgcctttggtggctttcacattgaaagaccac
acccactttgatgagttccaaatctctgatctgctgaggcgctttgggtggatagtgcca
gcatacaccatgcccccagatgctcaacatgtcaccgtgctacgtgttgtcatcagggag
gacttctcaagaaccctcgcagagcgtcttgtggctgatgtggagaaggtgctgcatgag
cttgattcacttccagcaagggtgataagtagcacctctgtcacagtcaatacagaacaa
aatggcaaggtggtggttgccaagaagagtgctctagagacacagagggaaatcactgcg
atttggaagaagttagtgttggagaggaagaagctgaatgacaagatgatggtgtgtgtt
agacttagctttgattga

KEGG   Cajanus cajan (pigeon pea): 109796723Help
Entry
109796723         CDS       T04868                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00410  beta-Alanine metabolism
ccaj00430  Taurine and hypotaurine metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Module
ccaj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109796723
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109796723
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109796723
   00430 Taurine and hypotaurine metabolism
    109796723
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109796723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 FtsL
Motif
Other DBs
NCBI-GeneID: 109796723
NCBI-ProteinID: XP_020212075
LinkDB All DBs
Position
1
AA seq 413 aa AA seqDB search
MQNRCVNMIAHLFNAPLGESEAAVGVGTVGSSEAIMLAGLAFKRKWQNRRKEEGKPYDKP
NIVTGANVQVCWEKFARYFEVELKEVNLRDGYYVMDPEKAVELVDENTICVAAILGSTLN
GEFEDVKRLNDLLVEKNKQTGWKTPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSG
HKYGLVYAGIGWVIWRSKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLVRL
GYEGYRNVMENCRDNMIVLKEGLEKTGRFDIVSKENGVPLVAFTLKDHTHFDEFQISDLL
RRFGWIVPAYTMPPDAQHVTVLRVVIREDFSRTLAERLVADVEKVLHELDSLPARVISST
SVTVNTEQNGKVVVAKKSALETQREITAIWKKLVLERKKLNDKMMVCVRLSFD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatcggtgtgtaaatatgatagctcatcttttcaatgcaccattaggagagtct
gaggctgcagttggtgttggcacagttggttcatctgaggccataatgttggctggattg
gcattcaaaaggaagtggcagaacagaaggaaagaagagggaaagccttatgacaaaccc
aacattgtcactggagccaacgttcaggtttgctgggagaaatttgccaggtactttgag
gtggagttaaaggaagttaatttgcgtgatggatactatgtgatggaccctgaaaaggcc
gtggaattggtggatgagaacactatttgtgttgctgctatccttggttctacgctaaat
ggagagtttgaagatgtcaaacgcttgaatgatctcctggttgaaaagaataagcaaact
ggatggaagactcctattcatgtggatgcagctagtggtgggttcattgcaccatttatt
tatccagagcttgagtgggactttcggttaccgctggtgaagagcatcaatgttagtggg
cacaagtatggtctggtctatgctggaatcggttgggttatttggagaagcaaggaagac
ttgcctgaggaacttatcttccatatcaactatctcggtgctgatcaacccacctttacc
cttaacttctctaaagggtctagccaagtcattgctcaatactaccaactagttcgcctt
ggctatgagggatatagaaacgtgatggaaaattgtagagacaacatgatagtgctgaaa
gagggactcgagaaaacagggcggtttgacattgtgtcgaaagagaatggtgtgcctttg
gtggctttcacattgaaagaccacacccactttgatgagttccaaatctctgatctgctg
aggcgctttgggtggatagtgccagcatacaccatgcccccagatgctcaacatgtcacc
gtgctacgtgttgtcatcagggaggacttctcaagaaccctcgcagagcgtcttgtggct
gatgtggagaaggtgctgcatgagcttgattcacttccagcaagggtgataagtagcacc
tctgtcacagtcaatacagaacaaaatggcaaggtggtggttgccaagaagagtgctcta
gagacacagagggaaatcactgcgatttggaagaagttagtgttggagaggaagaagctg
aatgacaagatgatggtgtgtgttagacttagctttgattga

KEGG   Cajanus cajan (pigeon pea): 109805055Help
Entry
109805055         CDS       T04868                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00410  beta-Alanine metabolism
ccaj00430  Taurine and hypotaurine metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Module
ccaj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109805055
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109805055
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109805055
   00430 Taurine and hypotaurine metabolism
    109805055
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109805055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 109805055
NCBI-ProteinID: XP_020222591
LinkDB All DBs
Position
9
AA seq 485 aa AA seqDB search
MVFPKPPSESDLFLHSNFASRYATDSLPRFCMPEDSMPKEAAYQNIHDELQLDAIPKLNL
ASFVTTSMEEECNKLIMESINKNYVDMDEYPITTDLHNRCVNMIARLFHAEIGENETAIG
AGTVGSSEAIMLAGLAFKKKWQNKRKAEGKPYDKPNLVTGSNVQVCWEKFARYFEVELRE
VEVREGYYVMDPAKAVELVDENTICVAAILGSTYNGEFEDVKLLNDLLLEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRTKDDLPEDL
VFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGQEGYRSIMENCRENAMVVKEHLDK
SGRFNILSKDNGVPVVAFSLKDRSEFDEYKISEMLRRHGWIVPAYPMPPAAQHINVLRVV
IRAEFSRTLAERLVFDIHNVLHELETEHPHKVTKNIEEDKTHTALDAHREIIAQESNKRQ
KIVAA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggtttttccaaaacctccttctgaatctgatctctttcttcattccaactttgcttct
cgttatgccaccgactctcttcctaggttctgcatgcccgaggactccatgcctaaggag
gctgcttaccagaacattcacgatgagttgcagcttgatgccattccaaagcttaacttg
gcttcctttgtcaccacttccatggaagaagagtgcaacaaactcatcatggaatccatc
aacaagaactatgtcgacatggacgagtatccaatcaccactgaccttcacaatcggtgt
gtgaacatgatagcacgtttgttccatgctgaaattggagaaaacgagactgcaattgga
gcaggaactgttggttcatcggaggccataatgctggcagggcttgcattcaagaagaag
tggcagaacaaacgcaaggcagagggaaagccttatgataagcccaatttggtcactggt
tccaatgtccaggtatgttgggagaagtttgcaaggtattttgaggtggagttaagggaa
gtggaggtgagggaagggtactatgtgatggaccctgccaaagccgttgagctggttgac
gagaacactatttgtgtggctgcaatcttgggttcaacttacaacggagagttcgaagat
gtgaagctcctaaatgatctacttctagagaaaaacaagcaaactggatgggatacacct
attcatgtggatgctgctagtggtggctttattgctccattcctttatccagaactagaa
tgggatttcagactcccattggtgaagagcataaatgttagtggccacaagtatggtctt
gtttatgctggaattggttgggtcatatggaggaccaaggatgacttgccagaagacctt
gtcttccatattaattaccttggtgctgaccaacccaccttcaccctcaatttctctaaa
ggttctagtcagataattgctcaatattatcagctaattcgccttggccaagaggggtac
cgtagcataatggagaactgcagagaaaacgcaatggtggtgaaggagcatttggacaag
agtggacggtttaacatactctcaaaagacaatggtgttccagtggtggcattttccttg
aaagacagaagcgaattcgatgagtacaagatatcagagatgttgcggcgccacggttgg
atcgtgccagcatatccaatgccacctgcggctcagcacatcaatgtgcttcgtgtggtc
ataagagcagagttttcacgcactcttgctgaacgccttgtgtttgacatacacaatgtg
ttgcatgaacttgaaacagaacatccccacaaagtgaccaaaaacattgaggaagacaaa
actcacactgcgttggatgcgcatagggaaatcattgcccaagaatccaacaagcgtcag
aaaatcgtggctgcgtag

KEGG   Cajanus cajan (pigeon pea): 109805069Help
Entry
109805069         CDS       T04868                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00410  beta-Alanine metabolism
ccaj00430  Taurine and hypotaurine metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Module
ccaj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109805069
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109805069
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109805069
   00430 Taurine and hypotaurine metabolism
    109805069
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109805069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 109805069
NCBI-ProteinID: XP_020222608
LinkDB All DBs
Position
9
AA seq 499 aa AA seqDB search
MVFPKPPSESDLFLHSNFASRYATDSLPRWCMPENSMPKEAAYQNIHDELQLDAIPKLNL
ASFVTTSMEEECNKLIMESINKNYVDMDEYPATTDLHNRCVNMIARLFHAEVGENENAIG
AGTVGSSEAIMLAGLAFKKKWQNKRKAEGKPCDKPNLVTGSNVQVCWEKFARYFEVELRE
VEVREGYYVMDPAKAVELVDENTICVAAILGSTYNGEFEDVKLLNDLLLEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRTKDDLPEDL
VFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGQEGYRSIMENCRENAMVVKKHLEK
SGRFHILSKDNGVPVVAFSLKDRSEFDEYKISEMLRRHGWIVPAYPMPPAAQHINVLRVV
IRAEFSRTLAERLVFDIHNVLHELEKEHPHKVINNNNNNIKEEKKGLVDIGVKNTNTALD
AHREIIAQESNKRHKIMAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtttttccaaaacctccttctgaatctgacctctttcttcattccaattttgcttct
cgttatgccaccgactctcttcccaggtggtgcatgcccgagaactccatgcctaaggag
gctgcctaccagaacattcacgatgagttgcagcttgatgccattccaaagcttaactta
gcttcctttgtcaccacctccatggaagaagagtgcaacaaacttattatggaatcgatc
aacaaaaactatgtcgacatggacgagtatcctgccaccactgaccttcacaatcggtgc
gtgaacatgatagcacgtttgttccatgctgaagttggagaaaatgagaatgcaattgga
gcaggaactgttggatcatcagaggccataatgctggcagggcttgcattcaagaagaag
tggcagaacaaacgcaaggcagagggaaagccttgtgataagcccaatttggtcactggt
tccaatgtccaggtatgttgggagaagtttgcaaggtattttgaggtggagttaagggaa
gtggaggtgagggaagggtactacgtgatggaccctgccaaagccgttgagctggttgat
gagaacactatttgtgtggctgcaatcttgggttcaacttacaacggagagttcgaagat
gtgaagctcctaaatgatctacttctagagaaaaacaagcaaactggatgggatacacct
attcatgtggatgctgctagtggtggctttattgctccattcctttatccagaactagaa
tgggatttcagactcccattggtgaagagcataaatgttagtggccacaagtatggtctt
gtttatgctggaattggttgggtcatatggaggaccaaggatgacttgccagaagacctt
gtcttccatattaattaccttggtgctgaccaacccaccttcaccctcaatttctctaaa
ggttctagtcagataattgctcaatattatcagctaattcgcctcggccaagaggggtac
cgtagcataatggagaactgcagagaaaacgcaatggtggtgaagaaacatttggagaag
agtggacggttccacatactctcaaaagacaatggtgttccagtggtggcattttccttg
aaagacagaagcgaattcgatgagtacaagatatcagagatgttgcggcgccacggttgg
atcgtgccagcatatccaatgccacctgcggctcagcacatcaatgtgcttcgtgtggtc
attagagcagagttttcacgtacccttgctgaacgccttgtgtttgacatacacaacgtg
ttgcatgaactcgaaaaagaacatccccacaaagtgatcaacaacaacaacaacaacatt
aaggaagagaagaaggggttggttgatattggagtgaagaacacaaacactgcattggat
gcacacagggaaatcattgcccaagaatccaacaagcgtcacaaaatcatggctgcgtag

KEGG   Cajanus cajan (pigeon pea): 109812109Help
Entry
109812109         CDS       T04868                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00410  beta-Alanine metabolism
ccaj00430  Taurine and hypotaurine metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Module
ccaj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109812109
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109812109
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109812109
   00430 Taurine and hypotaurine metabolism
    109812109
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109812109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 109812109
NCBI-ProteinID: XP_020231574
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MVITSTVTHPDEQRESLCSTFASRYVREPIPRFKIPENSTPKDAAYQIINDELMLDGTPR
LNLASFVTTWMEPECDKLIMASLNKNYVDMDEYPVTTELQNRCVNIIANLFHAPINEDET
AVGVGTVGSSEAIMLAGLAFKRKWQRKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVE
LKEVKLTEGYYVMDPVKAVEMVDENTICVAAILGSTMTGEFEDVKLLNELLTKKNSETGW
DTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKDDLP
DELVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNIMENCLENARILKEG
LERTGRFNIISKDIGVPLVAFSLKDSSQHTVFEISDHLRKFGWIVPAYTMPPDAQHIAVL
RVVIREDFSRSLAERLAHDIEKVVKLLDALPSPLSTRAAHVTAITSETSEKVNKSALETQ
KEIALYWKRLVDGKKLGAC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcacatctactgtcacacacccagatgaacaaagagagagtttgtgctctact
tttgcttccagatatgtgcgtgaaccaattcccaggttcaagataccagagaattccaca
ccaaaggatgctgcttatcagataataaacgatgagttgatgttggatggcacaccaagg
ctcaacttggcctcatttgtgaccacttggatggagcctgagtgtgacaaactcataatg
gcttcacttaacaagaactatgttgacatggatgagtatcctgtcaccactgagcttcag
aaccggtgtgttaatattatagcaaatctattccatgctcctataaatgaagatgagact
gcagtaggtgtgggaactgtgggatcatcagaggcaataatgttagcaggtctagctttc
aaaaggaaatggcagagaaagagaaaagcagaaggaaaaccatatgataagcccaacata
gttaccggggctaatgtgcaggtttgttgggaaaaatttgcaaggtactttgaggtggag
ctcaaggaagtgaaactcactgagggatactatgtgatggaccctgtgaaagcagttgaa
atggtagatgagaacaccatctgtgttgcagccattttggggtcaactatgactggagag
tttgaggatgtgaagcttctcaatgaacttctcactaagaagaacagtgagacagggtgg
gacaccccaattcatgttgatgctgccagtggcgggtttattgccccatttctctatcct
gatctggagtgggattttcgtttgccattggtgaaaagcatcaatgttagtggtcacaag
tatggtcttgtctaccctggtgttggttgggttgtctggaggagtaaagatgacttgcca
gatgaacttgtttttcacataaattatcttggatctgatcagcctactttcacattgaat
ttctccaaaggatctagtcaaattattgctcaatattatcaatttatccggcttggcttt
gagggctacaaaaacatcatggaaaactgcttggagaatgcaagaattctgaaggaagga
cttgagagaacaggcaggtttaacatcatctccaaggatattggcgtgccgcttgtggcc
ttctctttgaaagacagcagccagcacacagtgtttgagatatcagaccacctcagaaaa
ttcggctggatagttccggcctacacaatgccgccagacgcgcaacacattgcagttctc
cgggtggtgatcagggaggatttcagccgcagcttggccgagagacttgctcatgacata
gagaaagttgtgaagctcttggacgcgcttccaagccccctctctaccagggctgcccat
gtcacagccatcactagtgagactagtgagaaagttaataagagtgcattagagactcaa
aaagagattgctttgtattggaagagacttgtggatggcaagaaacttggagcatgttag

KEGG   Cajanus cajan (pigeon pea): 109814163Help
Entry
109814163         CDS       T04868                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00410  beta-Alanine metabolism
ccaj00430  Taurine and hypotaurine metabolism
ccaj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109814163
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109814163
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109814163
   00430 Taurine and hypotaurine metabolism
    109814163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC DUF1725
Motif
Other DBs
NCBI-GeneID: 109814163
NCBI-ProteinID: XP_020234116
LinkDB All DBs
Position
Unknown
AA seq 105 aa AA seqDB search
MVLSKPASQTDVSVHSTFASRYVRASLPRFKMPEQSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQDCVNEGLE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggttctttcgaaacctgcctctcagacagatgtctctgtccattcaaccttcgcctct
cgctatgtccgcgcctccctccccaggttcaagatgccggaacaatcgattccgaaggaa
gcggcgtaccagatcataaacgacgagctgatgcttgacgggaaccctcggctgaacctg
gcctcctttgtgacgacgtggatggagcctgaatgcgacaaactcatcatggctgccatc
aacaaaaactacgtcgacatggatgagtaccctgtcaccactgagctccaggattgtgtt
aacgagggacttgaataa

KEGG   Cajanus cajan (pigeon pea): 109814176Help
Entry
109814176         CDS       T04868                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00410  beta-Alanine metabolism
ccaj00430  Taurine and hypotaurine metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Module
ccaj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109814176
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109814176
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109814176
   00430 Taurine and hypotaurine metabolism
    109814176
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109814176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109814176
NCBI-ProteinID: XP_020234133
LinkDB All DBs
Position
Unknown
AA seq 501 aa AA seqDB search
MVLSKTASQTDVSVHSTFASRYVRASLPRFKMPEQSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEESETAVG
VGTVGSSEAIMLAGLAFKRRWQNRRKQEGKPIDSPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKSLNDLLLAKNEETGWNTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKMVMENCTDNMVVLKEGLEK
TGRFAIVSKDVGVPLVAFTLKDRNHFDEFQISDMLRRYGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVSDVTKVLHELDSLPARVISNTVTAAGEDVDNGAKVLVAKKSEIETQ
REITSAWKKFVMERKKMNCVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttctttcgaaaactgcctctcagacagatgtctctgtccattcaaccttcgcctct
cgctatgtccgcgcctccctccccaggttcaagatgccggaacaatcgattccgaaggaa
gcggcgtaccagatcataaacgacgagctgatgcttgacgggaaccctcggctgaacctg
gcctcctttgtgacgacgtggatggagcctgaatgcgacaaactcatcatggctgccatc
aacaaaaactacgtcgacatggatgagtaccctgtcaccactgagctccagaaccggtgt
gttaacatgatagctcatcttttcaatgcaccacttgaagagtcagaaactgcagttggt
gttggcaccgttggctcatcagaggccataatgttggctggattagcattcaaaaggagg
tggcaaaacagaaggaaacaagaagggaagccaattgacagtcctaacattgtcactggt
gccaatgttcaggtttgctgggagaaatttgcaaggtactttgaggtggagttgaaagag
gtgaagctgcgtgatggatactatgtaatggaccctgaaaaggctgtggaaatggtggat
gagaacaccatttgtgttgcggccatccttggttccactctgaatggagagtttgaagat
gttaagagcttaaacgatctcctcctggcaaagaatgaggaaactggatggaacactcca
attcatgtggatgcagccagtggtggattcattgcaccctttctttatccagagctagag
tgggattttcggttaccactagtgaagagcatcaatgttagtggacacaaatatggtcta
gtctatgctggaattggttgggtcatttggagaagcaaggaagaccttcctgacgaactc
attttccacattaactatcttggagctgatcaacccaccttcaccctcaacttctccaaa
ggttctagccaagttattgctcagtactaccaactcattcgattgggttatgagggctat
aaaatggtgatggaaaactgcacagacaacatggtagtgctgaaggaaggactagagaaa
acagggcggtttgcaattgtatcgaaagacgttggtgtgccattggttgcgttcacattg
aaggatcgtaaccactttgatgaattccaaatctctgatatgctgaggcgttatggatgg
atagtgccagcatacacgatgcccccagatgcacagcatgtgacagtgctacgtgttgtg
atcagggaggacttttctcgcaccctcgccgagcgtcttgtgagtgatgtcaccaaagtg
ttgcacgagctcgattcgcttcctgctcgggtcatcagcaacaccgtcactgctgccgga
gaagatgtcgataatggggccaaggtgctcgttgccaagaagagtgaaattgagacacaa
agggaaatcacttcagcttggaagaagtttgtcatggagaggaagaagatgaactgtgtt
tgttaa

KEGG   Cajanus cajan (pigeon pea): 109817652Help
Entry
109817652         CDS       T04868                                 

Definition
(RefSeq) glutamate decarboxylase 4 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00410  beta-Alanine metabolism
ccaj00430  Taurine and hypotaurine metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Module
ccaj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109817652
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109817652
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109817652
   00430 Taurine and hypotaurine metabolism
    109817652
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109817652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 FtsL
Motif
Other DBs
NCBI-GeneID: 109817652
NCBI-ProteinID: XP_020238598
LinkDB All DBs
Position
1
AA seq 503 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRTSLPRFKMPEESIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESQAAVG
VGTVGSSEAIMLAGLAFKRKWQNRRKEEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VNLRDGYYVMDPEKAVELVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKQTGWKTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNVMENCRDNMIVLKEGLEK
TGRFDIVSKENGVPLVAFTLKDHTHFDEFQISDLLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVADVEKVLHELDSLPARVISSTSVTVNTEQNGKVVVAKKSALETQRE
ITAIWKKLVLERKKLNDKMNGVC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaaaaccgcctccgaatccgacgtctctgtccactcaaccttcgcttct
cgctatgtcagaacttcacttcccaggtttaagatgccggaggagtccataccgaaggag
gcagcgtaccagatcataaacgacgagttgatgttggacgggaatccgaggctgaacctg
gcgtcgtttgtgacaacttggatggaacctgagtgtgataaactcatcatggcttccatt
aataagaactatgttgacatggacgagtaccctgtcactaccgagctacagaatcggtgt
gtaaatatgatagctcatcttttcaatgcaccattaggagagtctcaggctgcagttggt
gttggcacagttggttcatctgaggccataatgttggctggattggcattcaaaaggaag
tggcagaacagaaggaaagaagagggaaagccttatgacaaacccaacattgtcactgga
gccaacgttcaggtttgctgggagaaatttgccaggtactttgaggtggagttaaaggaa
gttaatttgcgtgatggatactatgtgatggaccctgaaaaggccgtggaattggtggat
gagaacactatttgtgttgctgctatccttggttctacgctaaatggagagtttgaagat
gtcaaacgcttgaatgatctcctggttgaaaagaataagcaaactggatggaagactcct
attcatgtggatgcagctagtggtgggttcattgcaccatttatttatccagagcttgag
tgggactttcggttaccgctggtgaagagcatcaatgttagtgggcacaagtatggtctg
gtctatgctggaatcggttgggttatttggagaagcaaggaagacttgcctgaggaactt
atcttccatatcaactatctcggtgctgatcaacccacctttacccttaacttctctaaa
gggtctagccaagtcattgctcaatactaccaactaattcgccttggctatgagggatat
agaaacgtgatggaaaattgtagagacaacatgatagtgctgaaagagggactcgagaaa
acagggcggtttgacattgtgtcgaaagagaatggtgtgcctttggtggctttcacattg
aaagaccacacccactttgatgagttccaaatctctgatctgctgaggcgctttgggtgg
atagtgccagcatacaccatgcccccagatgctcaacatgtcaccgtgctacgtgttgtc
atcagggaggacttctcaagaaccctcgcagagcgtcttgtggctgatgtggagaaggtg
ctgcatgagcttgattcacttccagcaagggtgataagtagcacctctgtcacagtcaat
acagaacaaaatggcaaggtggtggttgccaagaagagtgctctagagacacagagggaa
atcactgcgatttggaagaagttagtgttggagaggaagaagctgaatgacaagatgaat
ggtgtgtgttag

DBGET integrated database retrieval system