KEGG   Cajanus cajan (pigeon pea): 109792814Help
Entry
109792814         CDS       T04868                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 4-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00620  Pyruvate metabolism
ccaj00710  Carbon fixation in photosynthetic organisms
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Module
ccaj_M00168  CAM (Crassulacean acid metabolism), dark
ccaj_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ccaj_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ccaj_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109792814
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109792814
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109792814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 109792814
NCBI-ProteinID: XP_020207844
LinkDB All DBs
Position
Unknown
AA seq 1054 aa AA seqDB search
MTDITDDIAEEISFHLFDDDCRLLGNLLKDILQREVGTTFVDKLEKIRVLSQSACNMRQA
GIEDMAELLEKQLASELSKMTLEEALTLARAFSHHLTLMGIAETHHRVRKGGNLAYVAKS
CDDIFNQLLQAGVSPDDLYSTVCKQEVEIVLTAHPTQINRRTLQYKHIKIAHLLDYNDRP
DLGPEDRDMVIEDLVREITSIWQTDELRREKPTPVDEARAGLNIVEQSLWKAVPHYLRRV
SSALKKHTGKPLPLTCTPIKFGSWMGGDRDGNPNVTAKVTKDVSLLSRWMAIDLYVREVD
SMRFELSMNRCSDKLLRLAHEILEETNNEEDRREHWNESVSRSQFKSPNQQALPFPTKLP
SGAHLPSCAEKGGSEHPRLMPGADQKKPNHKDGGISSSTESNSGNRNVRSSIPISPSSSA
TSLASMTRSPSFNSSQLHAQRKLFAESQIGRTSFQKLLEPKLPQFPGIAPYRVVLGHVKD
KLVKTRRWLELLIEDGPCEHNPMDYYETTEQLLEPLLLCYESLQSCGSGVLADGRLADII
RRVATFGMVLMKLDLRQESGRHAETLDAITRYLDIGKYSEWDEEKKLDFLTKELKGKRPL
VPVSIEVSPDVREVLDTFRTAAELGSDSFGAYVISMASNASDVLAVELLQKDARLAVSGE
LGRACPGGTLRVVPLFETVKDLRGAGSVIRKLLSIDWYRQHVIKNHNGHQEVMVGYSDSG
KDAGRFTAAWELYKAQEDVVAACKEYGIKVTLFHGRGGSIGRGGGPTYLAIQSQPPGSVM
GTLRSTEQGEMVQAKFGLPQTAVRQLEIYTTAVLLATLRPPLPPREEKWRNLMEDISKIS
CQCYRNVVYENPEFLSYFHEATPQAELGFLNIGSRPTRRKSTTGIGHLRAIPWVFAWTQT
RFVLPAWLGVGAGLQGVIEKGQSDELKAMYKEWPFFQSTIDLIEMVLGKADIPIAKHYDE
VLVSQQRQELGTQLRNELITTGKFVLVVSGHEKPQENNKSLRRLIESRLPFLNPMNMLQV
EILKRLRCDDDNLKARDALLITINGIAAGMRNTG
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgacggacatcactgacgacatagcggaggaaatctcattccatctcttcgatgatgac
tgtagattgttgggaaaccttctcaaagacattttgcagagagaggttggcaccaccttc
gttgacaagcttgaaaaaattcgagtcctttcacagagtgcttgtaatatgagacaggca
gggattgaggacatggctgagctactggaaaaacaattggcttcagagttgtccaagatg
acactagaagaagctctaacacttgctcgtgcctttagccatcatcttactttgatgggt
atagctgaaacccaccatagggttcgtaaaggaggaaatttggcttatgttgcaaaatct
tgcgatgatatctttaaccagttgttgcaagctggtgtttctcctgatgatctttatagc
acagtttgcaagcaggaggtggaaatcgttctcacagctcatccgactcaaattaatcgc
cgtaccttgcaatacaaacacattaaaattgctcatcttttagattataatgatcgacct
gatcttggccctgaagatcgagatatggttatcgaagatctggtaagagagataacttca
atatggcagacagatgagcttaggcgcgagaaacccacaccagttgatgaagccagggct
ggattgaatattgtggagcaatcactctggaaagctgttcctcattatttacgtcgagtt
agcagcgctttaaagaagcacacgggaaaaccacttccattgacttgcactcccattaag
tttggatcttggatgggaggtgatagagacggaaacccaaatgtgacagcaaaggtcaca
aaagatgtttcacttctatcaagatggatggcaattgacctctatgttcgggaagtggat
agcatgagatttgagttatccatgaaccggtgtagcgataagctgttaagactagcacat
gaaattctagaagaaactaacaatgaggaggatcgccgtgaacattggaatgaatctgtg
agtagaagtcaattcaaaagtcctaatcaacaagctttaccatttccaactaaacttcca
tctggagctcatttaccctcttgtgctgaaaagggtggatctgagcatcccagactcatg
ccaggagctgatcaaaagaaacccaatcacaaggatggtgggatttcaagttcaactgag
agcaatagtggcaatcgcaatgttcgttcatcaataccaatttcaccaagttccagtgct
acttcattagcttcaatgacacgctctccttctttcaactctagtcaacttcatgctcag
aggaaattgtttgcagaatcccagataggaagaaccagttttcagaagcttttggagcca
aagctccctcagtttcctggaattgctccttatagagttgttcttggacatgtaaaagat
aagcttgttaaaactcgtagatggttggagcttcttattgaggatggtccatgtgagcat
aatcctatggattattatgaaacaacagagcaacttttggaacctctgcttctttgttat
gaatctctgcaatcatgtggatctggggtgctagctgatggtcgacttgctgatataatt
cgaagagttgctacctttggcatggtgttaatgaagcttgatttgcgtcaagaatctggc
agacatgctgaaacactagatgcaattacaaggtatttggatattggtaaatacagtgaa
tgggatgaagaaaagaaactggacttcttaactaaagagttgaaagggaagaggccactg
gttccagttagtatagaggtttctccagatgttagagaagtgttggatacgttccgaact
gcggctgagctagggagtgattcatttggtgcctatgtgatctctatggcctcaaatgca
agtgatgttcttgcagtagagcttttgcagaaggatgcacgacttgctgttagtggggag
ttaggaagagcatgtcctggtggaacgttgcgggtggttcctctatttgaaactgtgaag
gacctgagaggagctggttcagttatcagaaagcttttgtcaatagattggtaccgccaa
cacgtcattaaaaaccataatgggcatcaagaggttatggttgggtattctgattctggt
aaagatgctgggcgctttactgctgcttgggaactctacaaagctcaggaggatgttgtg
gctgcatgcaaggaatatggtattaaggttactctcttccatggccgtggagggagtatt
ggccgtggtggtggcccaacatatctggctattcagtctcaaccacccggctctgtgatg
ggaacccttcgttcaactgagcaaggagagatggtgcaggccaagtttggcctgccacag
acagctgttagacagcttgagatatacacaacagctgtgctacttgctacccttcgtcca
cctctcccgccaagagaagaaaaatggcgcaatctcatggaagatatctcaaagatcagt
tgccagtgttaccgcaatgtagtatatgaaaatccagaattcctgtcctacttccatgaa
gccacacctcaagcagagctaggcttcctcaacataggcagccgccccacaaggcgaaag
agcacgaccggaattggccaccttcgtgccattccgtgggtgtttgcatggactcaaacc
aggtttgtccttccagcctggcttggagttggagcaggcttgcaaggtgttattgagaaa
ggacaaagtgatgagctaaaggccatgtacaaagagtggcctttctttcaaagcacaata
gacttgattgagatggttttgggaaaagcagatattcctattgctaagcactatgatgaa
gttcttgtctcacagcagaggcaagaacttggaactcaactgaggaatgagctcatcaca
actggcaagtttgtgctagtggttagtggccatgagaagcctcaggagaataacaagagc
ctaaggaggcttattgagagtagacttccctttctcaatcccatgaatatgttgcaagta
gagatactcaagaggctaagatgtgatgatgacaaccttaaagccagagatgccttgctt
atcaccataaatggtattgctgcagggatgaggaacactggttaa

KEGG   Cajanus cajan (pigeon pea): 109805576Help
Entry
109805576         CDS       T04868                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00620  Pyruvate metabolism
ccaj00710  Carbon fixation in photosynthetic organisms
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Module
ccaj_M00168  CAM (Crassulacean acid metabolism), dark
ccaj_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ccaj_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ccaj_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109805576
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109805576
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109805576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 109805576
NCBI-ProteinID: XP_020223305
LinkDB All DBs
Position
10
AA seq 967 aa AA seqDB search
MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV
YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK
LKKGDFADENNATTESDIEETLKRLVVDLKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHGRVRNCLTQLYAKDITPDDKQELDEALQREVQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPTFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRADELNRSSKKDAVAKHYIEFWKT
IPPNEPYRVLLGEVRDRLYQTRERSRHLLAHGHSDIPEEETFTNVEEFLEPLELCYRSLC
ACGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLEIGSYQEWSEE
KRQQWLLSELSGKRPLFGPDLPQTEEIRDVLDTFHVIAELPADNFGAYIISMATAPSDVL
AVELLQRECHVKHPLRVVPLFEKLADLEAAPAALARLFSVDWYRNRINGKQEVMIGYSDS
GKDAGRFSAAWQLYKAQEELIKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEQHLCFRTLQRYTAATLEHGMHPPISPKPEWRALMDEMAVIA
TEEYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPAKRRPSGGIETLRAIPWIFAWTQT
RFHLPVWLGFGAAFKHVIEKDVRNIHMLQEMYNQWPFFRVTLDLVEMVFAKGDPGIAALY
DRLLVSKDLWPFAEQLRTKYEETKELLLQVAAHRDLLEGDPYLKQRLRLRDSYITTLNVC
QAYTLKRIRDPNYNVKLRPHISKESIEISKPADELITLNPTSEYAPGLEDTLILTMKGIA
AGLQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaggaacttagaaaagatggcttcaattgatgctcagcttcggctgttggtt
ccagccaaagtgagtgaggatgataaactggttgagtatgatgctttgctcttggatcgg
ttccttgatattcttcaggatttacatggagaggatctgaaggaaacggttcaagaggtg
tatgagctttctgctgaatatgaagggaagcatgacccaaagaaactggaggaacttgga
aatctgataactagtttggatgctggagattccattgttgttgccaagtccttttcccac
atgcttaacttggccaacttagctgaagaggtccaaattgctcaccgcagaaggaacaag
ttgaagaaaggagattttgctgatgagaacaatgccacaactgaatcagacattgaagaa
actctcaagagacttgtggtggatttgaagaagtctcctcaggaagtttttgatgcactg
aaaaaccagaccgttgatctggttcttactgctcatcctactcaatcagtccgaagatct
ttgcttcaaaagcatggaagggtaagaaattgtttaactcagttgtatgccaaagacatc
actcctgatgataagcaggaacttgatgaggctctacagagggaggtccaagctgcattt
cgtactgatgaaatcaggaggacccctccaaccccacaagatgagatgagagcagggatg
agctacttccatgaaacaatttggaagggtgtacccacatttctgcgtcgtgttgataca
gctttgaagaatatagggattaatgaacgtgtcccttataatgctcctctcattcaattt
tcttcttggatgggtggagatcgtgatggcaatccaagagttactcctgaagtgaccaga
gatgtttgcttattggctagaatgatggctgctaatttgtactattcccagatagaggat
cttatgtttgaactgtcaatgtggcgctgcaatgatgagctacgtgtccgtgcagatgaa
cttaacagatcttccaaaaaagatgcagttgcaaaacactacatagaattttggaaaacc
attcctccaaatgagccatatcgtgtgttactgggtgaggtaagggacaggctttaccag
actcgtgagcgctcgcgccatttgctagctcatggccactctgacattccagaggaagaa
actttcaccaatgttgaggagttcttggaaccacttgaactgtgttacagatcactctgt
gcttgtggcgatcgcgcaattgccgatggaagccttcttgatttcttgaggcaagtctcc
acttttggactctccctagtgaggcttgacataaggcaagagtcagaccgccacactgac
gtcttagatgccatcaccaagcatttggaaataggctcataccaggaatggtctgaggaa
aaacgacaacaatggcttttatctgagttgagtggcaaacgacccctatttggccctgac
cttccccaaacagaagaaatcagagacgttttggacacatttcatgtcatagcagaactt
ccagcagacaactttggagcatacatcatctcaatggcaactgcaccatctgatgtgcta
gcagttgagcttctgcagcgggaatgccatgtcaagcatcccttaagagttgttccattg
tttgagaagctagctgatctagaagcagcgccggcggcgctggcacggttgttctcagta
gactggtacagaaacaggatcaatgggaagcaggaagtgatgattggctactctgattca
ggaaaagatgccggaaggttttcggcagcgtggcagctgtataaggctcaggaggagctc
ataaaggtggctaaggagtatggtgtgaagctgacaatgttccatggtcgtggagggact
gttggaagaggaggtggtccaactcaccttgctattctgtctcagcctccagatacaatt
catggatcactgcgtgtgactgtgcaaggtgaagttattgagcaatcttttggagagcag
cacttatgtttcagaacgctgcaaaggtacactgctgctactctagaacatggaatgcac
cctccaatttctcctaaaccagaatggagggctttgatggatgagatggctgtcattgcc
actgaggagtaccggtccattgtgttcaaagaaccacgttttgttgagtatttccgcctg
gctacacctgagttggagtatggaaggatgaacatcggaagtagaccagcaaagaggaga
ccaagtggaggtattgagacactgcgtgctataccttggatctttgcatggacacaaaca
aggttccatcttccagtgtggctaggctttggtgcagcttttaaacatgttattgagaag
gatgttaggaacattcatatgctgcaagagatgtacaatcaatggcctttctttagggtc
actcttgatttagtggaaatggtgtttgccaaaggagacccagggatagctgctctgtat
gataggctccttgtttcaaaggatctgtggccatttgcggagcaattgaggaccaagtat
gaagaaactaaggaactcctccttcaggtggctgcccacagggatcttcttgaaggagat
ccatacctgaagcaaagactccgtttgcgtgattcatacatcacaaccctaaacgtgtgc
caagcttacaccttgaaaagaatccgtgatccaaactacaacgtgaagctgcgtcctcac
atctccaaagagtccatagagataagtaagcctgctgatgaactcataacactcaacccc
acaagtgaatacgcccctggcttggaagacaccctcattctcaccatgaagggtattgct
gctggcttgcaaaacactggctaa

KEGG   Cajanus cajan (pigeon pea): 109810364Help
Entry
109810364         CDS       T04868                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00620  Pyruvate metabolism
ccaj00710  Carbon fixation in photosynthetic organisms
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Module
ccaj_M00168  CAM (Crassulacean acid metabolism), dark
ccaj_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ccaj_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ccaj_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109810364
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109810364
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109810364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 109810364
NCBI-ProteinID: XP_020229397
LinkDB All DBs
Position
Unknown
AA seq 967 aa AA seqDB search
MMATRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQD
CYELSAEYEGEHRPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRI
KLLKKGDFADENSAMTESDIEETFKRLVTQLKKTPQEIFDALKNQTVDLVLTAHPTQSVR
RSLLQKHGRIRNCLTQLYAKDITPDDKLELDEALQREIQAAFRTDEIRRTPPTPQDEMRA
GMSYFHETIWKGVPQFLRRVDTALKNIGIHERVPYNAPVIQFSSWMGGDRDGNPRVTPEV
TRDVCLLARMMAANLYFSQIEDLMFELSMWRCNDELRVRAHELHRSLKRDAKHYIEFWKQ
IPPNEPYRVILGDVRDKLYNTRERARQLLANGTSDIPEETTFTNVEQFLEPLELCYRSLC
ACGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITKHLDIGSYREWSEE
KRQEWLLSELRGKRPLFGHDLPKTEEINDVLETFHVISELPPDNFGAYIISMATAPSDVL
AVELLQRECRVKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYRDRINGKQEVMIGYSDS
GKDAGRLSAAWALYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDQMAAIA
TKEYRSVVFKEPRFVEYFRCATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGEAFKHVVEKDPKNLQVLQDMYNQWPFFRVTLDLVEMVFAKGDPGIAALY
DKLLVSGELWPFGECLRAKYEETKSFLLQVAAHKDLLEGDPYLKQRLRLRDSYITTLNVL
QAYTLKRIRDPDYHVKLRPHLSKDCMESSKPAAELVKLNPKSEYAPGLEDTLILTMKGIA
AGMQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgatggctactcgcaacattgagaagatggcctcaattgatgctcagttgaggttgctg
gcgccacgcaaggtgtctgatgatgacaaactcgttgagtatgatgctttgttgttggac
cgtttccttgacattcttcaggatttgcatggtgaagatatcagacaaacggtccaagat
tgttatgagctgtcagccgagtacgaaggagagcatcgtcctgaaaagttggaggaactt
gggaatatgctgactggtctagatgctggggattcaattgttattgccaagtcattttct
cacatgctcaatttggccaacttggcagaagaagttcaaattgcgtaccgaagaaggatc
aagctattgaagaagggtgattttgctgatgagaactctgccatgactgagtcagacatt
gaagagactttcaagaggcttgtgactcaactgaaaaagaccccccaggaaatctttgat
gctttgaagaaccaaactgtggatttggtcctaactgctcatcctactcagtctgttcgc
agatcgttgctgcaaaagcatggaaggataaggaattgtttgacacaattatatgctaaa
gacataacaccagatgacaagctggaacttgatgaggctttgcaaagagagattcaagct
gcatttcgcacagatgaaattcgaaggactcctccgacaccacaagatgagatgagggca
ggaatgagctactttcatgagacaatttggaaaggtgtaccacagtttctgcgccgggtt
gatacagctctgaagaacattggaatacatgaacgtgtcccatacaatgctcctgttatt
cagttctcttcttggatgggaggagatcgtgatggcaatcccagagtaacccctgaagtt
acaagggatgtgtgcttgctggctagaatgatggctgctaatttgtacttctctcagata
gaggatctcatgtttgagttgtctatgtggcgttgcaatgacgagctccgtgttcgtgct
catgaactccataggtccttaaagagagatgctaaacattatattgagttttggaaacag
attcctccaaacgagccatatcgtgttattcttggtgatgtcagagacaaactgtataac
acacgtgaacgtgctcgccagttattagccaatggaacgtctgatatccctgaggagaca
accttcactaatgttgagcagttcctggagcctcttgaactgtgttataggtcactctgc
gcatgtggtgaccgaccaatagcagatggaagcctccttgatttcctgaggcaagtttcc
acatttggactctcacttgtgaggcttgacatccgtcaagagtcagataggcacactgat
gtcatggatgcaatcacaaaacacttggatattggatcatacagagaatggtctgaggaa
aagaggcaagagtggctcttatcagaactcagaggaaagcgccctctctttggccatgac
cttcccaaaacagaagaaattaatgatgttttggaaactttccatgtgatctcagagctt
cccccagacaactttggtgcctacatcatatcaatggccacagcaccatctgatgtgctt
gcagttgagctcttacaacgcgaatgccgtgtgaagcagccactgagggtggtgccactg
tttgaaaagcttgctgatcttgaggctgcgccggcagcggtggcgcggcttttctccata
gattggtatagggaccgcatcaatgggaagcaagaggttatgatagggtactcggactca
ggaaaagatgcaggtcgtctctcagcagcttgggcgctttataaggctcaagaagagctt
gtgaaggttgctaaggagtatggtgtgaagctcacaatgttccatggaagaggaggcact
gttggaagaggaggaggaccaactcatcttgctatattgtctcagccaccagacaccatt
catggctcacttagagtaacggttcagggagaagtcattgaacagtcttttggagaggag
cacttgtgctttaggacacttcagcggttcactgctgctacacttgagcatggcatgcat
cctcctgtatcgccaaaaccggaatggcgtgccctcatggatcagatggctgccattgca
actaaggagtatcgctctgttgttttcaaagaacctcgttttgttgagtatttcagatgt
gcaactcctgagttggagtatggaagaatgaacattggcagtcgtccatcaaagcgaaag
ccaagtggaggaattgagtcactacgtgctattccttggatttttgcatggacacaaaca
aggttccatttgccagtgtggcttggctttggggaggcatttaagcatgtagttgagaag
gatccaaagaatctccaagtgcttcaggatatgtacaatcaatggcctttcttcagggtc
acccttgacttggttgaaatggtgtttgccaagggagatccagggattgcagccctttat
gacaagctcctggtatcaggagagctgtggccatttggagagtgtttaagagctaaatat
gaagaaaccaagagctttctcctccaggttgctgcgcacaaggatcttcttgaaggagac
ccctacttaaagcaaagacttcgtcttcgtgactcatacatcacaaccctgaacgtgttg
caagcctacacactgaagagaattcgtgatcctgattaccatgtgaagttgaggccacac
ttgtcaaaggactgcatggaatcaagcaagccagcagcagaacttgttaaacttaacccc
aaaagcgagtatgctcctggtcttgaggacacccttattttgacaatgaagggtattgct
gctggcatgcaaaataccggttaa

KEGG   Cajanus cajan (pigeon pea): 109810580Help
Entry
109810580         CDS       T04868                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 4-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00620  Pyruvate metabolism
ccaj00710  Carbon fixation in photosynthetic organisms
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Module
ccaj_M00168  CAM (Crassulacean acid metabolism), dark
ccaj_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ccaj_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ccaj_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109810580
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109810580
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109810580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 109810580
NCBI-ProteinID: XP_020229662
LinkDB All DBs
Position
Unknown
AA seq 1041 aa AA seqDB search
MTDITDDIAEEISFQSFDDDCRLLGNLLNDILQREVGTNLVDKIERIRVLAQSGCNMRQA
GIVNMAELLEKQLASELSEMTLEEAFTLGRAFSHYLTLMGIAETHHRVRKGGNVAQIAKS
CDDIFNQLVQGGVPPDELYDTVCKQEVEIVLTAHPTQINRRTLQFKHIRIAHLLDYNDRP
DLSVEDREMVIEDLVREITSIWQTDELRRQKPTPVDEARAGFNIVDQSLWKAVPHYLRRV
SNALKKHTGKPLPLTCTPIKFGSWMGGDRDGNPNVTAKVTKDVSLLSRWMAIDLYIREVD
SLRFELSMNQCSDRLSRLAHEILEANHEKHRRENWNQSVNRSHALPTQLPARAHLPSFAE
KGESQHPRLDIPGPDYMQSNHNKDGGVSLSSTTLKNVSPNIRLSVTNSANSSASSTANSS
STFNSGQKKLYAEPQTGKSTFQKLLEPMLPQLPGIAPYRIVLGNVKDKLEKSRRRLELLL
EDVACDYDPLDYFETSDQLLEPLLLCYESLQSCGSGVLADGRLADLIRRVATFGMVLMKL
DLRQESGRHAETLDAITRYLDMGTYSEWDEEKKLDFLTRELKGKRPLVPVSIEVPSDVKE
VLDTFRIAAELGSDSLGAYVISMASNASDVLAVELLQKDARLAAIGELGKACPGGTLRVV
PLFETVKDLRGAGSVIRKLLSIDWYREHIIKNHNGHQEVMVGYSDSGKDAGRFTAAWELY
KAQEDVVAACNDYGIKVTLFHGRGGSIGRGGGPTYLAIQSQPPGSVMGTLRSTEQGEMVE
AKFGLPQIAVRQLEIYTTAVLLATLRPPLPPREENWRNVMEEISNISCQSYRSVVYENPE
FLSYFHEATPEAELGFLNIGSRPTRRKASRGIGHLRAIPWLFAWTQTRFVLPAWLGVGAG
LKGACEKGHTEELKAMYKEWPFFQSTIDLIEMVLGKADIPIAKHYDEVLVSQERQELGRE
LRSELMTAEKFVMVISGHEKLQQNNRSLRRLIENRLPFLNPLNMLQVEILKRLRRDDDNL
KIRDALLITINGIAAGMKNTG
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatcactgatgatattgctgaggaaatctccttccagagcttcgatgatgac
tgcaggttgctcggtaatctcctcaatgacattctccagcgtgaggttggcaccaacttg
gttgacaaaatcgaaaggattcgagtccttgctcagagtggttgtaacatgaggcaagcc
ggtattgtcaacatggcagagctgcttgagaagcagttggcttcagagttgtcagagatg
acactagaagaagctttcacccttggtcgtgccttcagccattatcttactttgatgggt
atagctgagacccatcatagggttcgtaaaggagggaatgtggcacaaattgcaaaatct
tgcgatgatatatttaatcagctggtacagggtggtgttcccccagatgaactttatgac
acagtctgcaagcaggaggttgaaattgttcttactgctcatcccactcagattaaccgt
cgaaccttacaattcaaacacattagaattgctcatcttttggattataatgatcggcct
gatctcagcgtggaagatcgagaaatggtgatcgaagatctggtgagagagattacttca
atatggcagacagatgagctaaggcgacaaaaacccactccagttgatgaagctagagcc
ggtttcaatattgtggatcagtcgctttggaaagctgtccctcattatttacgtcgtgtc
agcaatgctttaaagaagcatacaggaaagccactgccattgacttgcactcccataaag
tttggatcttggatgggaggtgatagagatggaaacccaaatgtgacagcaaaggtcaca
aaagacgtttcacttctatctagatggatggcaattgacctctatattcgggaggtggat
agcctcagatttgagctatccatgaaccagtgcagtgataggttgtcaagactggcacat
gaaattctagaagctaaccatgagaagcatcgccgtgagaattggaatcaatctgtgaat
agaagtcatgcacttccaacacaacttccagctagagctcatttaccttcttttgctgaa
aaaggtgaatctcagcatcccagactagacattccaggacctgattacatgcaatccaat
cacaacaaggatggtggggtttctttaagctcaactacattaaaaaatgtcagtcccaac
attcgattatcagtgacaaattcagcaaattccagtgcttcttcaactgcaaattcatcc
tctactttcaattctggtcaaaagaaattgtatgcagaaccccagacaggaaagtccact
tttcagaagcttttggagccaatgcttcctcaacttccaggaattgctccttatagaatt
gtcctggggaatgttaaggataagcttgagaaaagtagaagacggttagaacttcttctt
gaggatgttgcatgtgactatgatcctttggattactttgaaacatctgatcagcttttg
gaacctctgctcctctgttatgaatctctgcaatcatgcggatctggggtgctagctgat
ggtcgacttgctgatctgattcggagagttgctacctttggaatggtgttaatgaagctt
gacttgcgtcaggaatctgggagacatgcagaaacacttgatgcaatcacaaggtatttg
gatatgggtacttatagtgaatgggatgaagaaaagaagttggacttcttaacaagagaa
ctaaaagggaagaggcctcttgttcctgttagtatagaggttccttctgatgttaaagaa
gtcctggacacattccgaattgccgctgaactggggagtgactcacttggagcttatgtg
atctctatggcctcaaatgcaagtgatgtccttgcagtagagcttttacagaaggatgca
cggcttgctgctatcggagagttgggaaaagcatgtcctggtggaacgttgcgggtggtg
cctctgtttgaaactgtgaaagaccttagaggagctggttcagttattcggaaactttta
tcaattgactggtaccgtgaacacatcattaaaaaccataatggacatcaagaggtcatg
gttggatattccgattctggtaaagatgctggccgctttactgctgcttgggaactttac
aaagctcaggaggatgttgttgctgcttgcaatgattatggtataaaggttacactattc
catggccgtggtgggagcattggtcgtggtggtggcccaacttatctggctattcagtcc
caaccccctgggtctgtgatgggaacccttcggtctactgagcagggagagatggtagag
gccaagtttggattgccacagatagctgtcaggcaacttgagatatacacaacagcagtg
ctacttgcaacccttcgtccacctctcccaccacgagaagaaaattggcgtaatgtcatg
gaagagatctcaaacatcagttgccagagttaccgcagcgtggtgtatgaaaatcctgaa
ttcctatcctacttccatgaagccacaccggaggcagaacttggcttcctcaacataggt
agccgccctacaagaaggaaggccagccgaggaattggacaccttcgtgcgattccttgg
ttatttgcatggactcaaacaagatttgttcttccagcttggcttggagttggagcaggt
ctaaaaggagcttgtgagaaaggtcacactgaagagcttaaagccatgtacaaagaatgg
cctttttttcaaagtaccatagaccttattgagatggttttgggcaaagcagatattcct
atagctaagcactatgatgaagtccttgtgtcacaggagaggcaagagcttggccgagaa
ttaagaagtgagctcatgacagctgaaaagtttgtgatggtgattagtgggcatgagaaa
cttcagcagaataataggagcttgaggaggctcattgagaatagacttccctttctcaat
cccttgaacatgttgcaagtggagatactcaagaggttgagacgtgatgatgacaacctt
aaaatcagagatgctttgcttatcaccataaatgggattgctgcagggatgaagaataca
ggttga

KEGG   Cajanus cajan (pigeon pea): 109811930Help
Entry
109811930         CDS       T04868                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00620  Pyruvate metabolism
ccaj00710  Carbon fixation in photosynthetic organisms
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Module
ccaj_M00168  CAM (Crassulacean acid metabolism), dark
ccaj_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ccaj_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ccaj_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109811930
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109811930
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109811930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 109811930
NCBI-ProteinID: XP_020231364
LinkDB All DBs
Position
Unknown
AA seq 971 aa AA seqDB search
MANRNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV
YELSAEYEGKHDPKKLEELGKVITSLNAGDSIVVAKSFSHMLNLANLAEEVQIARRRRNK
LKKGDFADENSATTESDIEETLKRLVFDLKKSPQEVFDALKNQTVDLVLTAHPTQSIRRS
LLQKHARIRNCLSHLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRAEELHRSSKKDEVAKHYIEFWKK
IPSNEPYRVVLGEVRDRLYQTRERSRHLLANGYSDIPEEAAFTYVEEFLEPLELCYRSLC
ACGDRAIADGSLLDFMRQVSTFGLSIVRLDIRQESDRHTDVMDAITKHLEIGSYQEWSEE
KRQEWLLSELSGKRPLFGPDLPQTEEIRDVLDTFHVIAELPSDSFGAYIISMATTPSDVL
AVELLQRECHIKNPLRVVPLFEKLNDLEAAPAALARLFSIDWYRNRINGKQEVMIGYSDS
GKDAGRFSAAWQLYKAQEELIKVAKKFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEHHLCFRTLQRFTAATLEHGMHPPISPKPEWRALMDQMAIIA
TEEYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPAKRRPSGGIETLRAIPWIFAWTQT
RFHLPVWLGFGAAFKKIIEKDVRNLNVLQEMYNQWPFFRVTLDLVEMVFAKGDPGIASLN
DKLLVSKDLWPFGDQLRSKYEETKKLLLQVAAHKEVLEGDPYLKQRLRLRDSYITTLNVF
QAYTLKRIRDPNYNVNERPSISKESVEKSVVSSKSADELVTLNPTSEYAPGLEDTLILTM
KGIAAGMQNTG
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaggaacatggaaaagatggcatctattgatgcacagcttaggcaattggct
cctgccaaagtgagtgaggatgacaaattgattgagtatgatgctcttcttcttgatcgg
ttccttgatattcttcaggatttacatggggaggatctgaaggaaacagttcaagaagtg
tatgagctttcagctgagtatgaaggaaagcatgaccctaagaaactggaagagcttgga
aaagtgataaccagtttgaatgctggggactctattgttgttgccaagtcctttagccac
atgcttaacttggccaacttggctgaagaggtccagattgctcggcggcgaaggaacaag
ttgaagaaaggggattttgccgatgagaacagtgcaactacagaatcagacattgaagaa
actctcaagagacttgtgtttgacttgaagaagtctcctcaggaagtttttgatgcactg
aaaaaccagactgttgatctggtgcttactgctcatcctactcaatcaattcgtagatct
ttgcttcaaaagcatgcaaggataaggaattgtttatctcatttgtatgccaaagacatt
actcctgatgataagcaggagcttgatgagtctctacaaagggagattcaagctgccttc
cgtacagatgaaatcaggaggacccctccaacaccacaagatgagatgagagcagggatg
agctacttccatgaaacaatttggaagggtgttcccaaatttctgcgccgtgttgataca
gctttgaagaacataggaattaatgagcgtgttccttataatgctccacttattcaattt
tcttcttggatggggggtgatcgcgatggtaatccaagagttactcctgaagtgacaagg
gatgtttgcttattggctagaatgatggctgctaatttgtattattcccagatagaagat
cttatgtttgaactttctatgtggcgttgcaatgatgaactacgtgttcgtgcagaagaa
cttcataggtcttccaagaaagatgaagttgcaaaacactacatagaattttggaaaaag
attccctcaaatgaaccatatcgtgtggtgctgggtgaagtaagggataggctctatcag
actcgtgagcgttctcgccatttgctagctaatgggtactctgacattccagaggaagcc
gctttcacctatgttgaggagttcctggagcctcttgagctatgctacagatcactgtgt
gcttgtggtgatagagcaattgctgatggaagccttcttgatttcatgagacaagtctcc
acttttggactgtcaatagtgaggcttgatatcaggcaagagtctgatcgtcacactgat
gtgatggatgccataaccaagcacttggaaattggctcctaccaggaatggtctgaagag
aaaagacaggaatggttgttatctgagttaagtggaaaaaggcctctatttggacctgac
cttccccaaactgaagaaatcagagatgttttggacacatttcatgtcatagcagaacta
ccatcagacagctttggagcctacatcatatcaatggcaactacaccatctgatgtgcta
gcagttgaacttctccaacgtgaatgccacatcaagaatccattaagagttgtgccattg
tttgaaaagctcaatgatctagaggcggcaccggcagctttggcgcggttgttctcgata
gactggtacagaaataggatcaatgggaagcaagaagtgatgattggttactcagactca
ggaaaagatgctggaagattctctgcagcatggcagctgtataaggctcaagaggaactt
ataaaggttgccaagaaatttggtgttaagttaaccatgttccatggtcgtggtggaact
gttggaagaggaggtggacctactcatcttgctattctgtctcagcctccagacacaatc
catggatcgcttcgtgtcacggtccaaggagaagttattgagcaatcatttggagaacac
cacttgtgctttagaacactgcaacgtttcactgctgccactctagagcatggcatgcat
ccaccaatttctcctaaaccagaatggcgtgccttgatggatcagatggctatcattgct
actgaggaataccgttcgattgtgttcaaggaaccgcgctttgttgaatatttccggctg
gctacaccagagttggagtatggaaggatgaatattggaagtcgaccagcaaagagaagg
cctagtggaggcattgaaacactgcgcgcaattccttggatctttgcatggacgcagaca
aggtttcatcttcctgtgtggctaggctttggagcagcatttaaaaagattattgagaaa
gatgttagaaatcttaatgtgctgcaagagatgtacaatcaatggcctttctttagggtc
acacttgatttagtggaaatggtgtttgccaaaggagacccaggaatcgcttctctgaat
gataagctccttgtttcaaaggatctatggccatttggggatcaactgaggagcaaatat
gaagaaactaagaagctcctacttcaggtggctgcacacaaggaagttctcgaaggggac
ccctacttgaagcaaagactgagacttcgtgattcctacattactaccctcaatgttttc
caagcttacacattgaaacgtatccgtgatcccaactacaatgtgaatgagcgccccagc
atatcaaaggaatctgtggagaagtctgttgtgtcgagtaaatcagctgatgaacttgtg
acactgaacccaacaagtgaatacgcccctggtttggaagacaccctcattctcaccatg
aagggtattgctgctggcatgcagaacactggttaa

KEGG   Cajanus cajan (pigeon pea): 109815935Help
Entry
109815935         CDS       T04868                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00620  Pyruvate metabolism
ccaj00710  Carbon fixation in photosynthetic organisms
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Module
ccaj_M00168  CAM (Crassulacean acid metabolism), dark
ccaj_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ccaj_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ccaj_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109815935
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109815935
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109815935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 MCM_N
Motif
Other DBs
NCBI-GeneID: 109815935
NCBI-ProteinID: XP_020236345
LinkDB All DBs
Position
Unknown
AA seq 966 aa AA seqDB search
MAARKLEKMASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGNDIRETVQDC
YELSAEYEGQNNPQKLEELGNMLTGLDAGDSIVISKSFAHMLNLANLAEEVQIAYRRRIK
LLKKGDFADENSAITESDIEETFKRLVNQLKKTPQEIFDALKSQTVDLVFTAHPTQSVRR
SLLQKHGRIRDCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANMYFSQIEDLMFELSMWRCNDELRGRSDELLSSSKRDAKHYIEFWKQI
PPNEPYRVILSDVRDKLYNTRERARQLLANGSSEILEETTFTNVEQFLEPLELCYRSLCA
CGDQPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITNHLEIGSYREWSEER
RQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVISELPSDSFGAYIISMATAPSDVLA
VELLQRECHVRNPLRVVPLFEKLADLEAAPAAVARLFSIDWYRDRINGKQEVMIGYSDSG
KDAGRLSAAWALYKAQEELIRVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFAAATLEHGMHPPVAPKPEWRALMDEMAVIAT
EEYRSIVFQEPRFVEYFRCATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFRHVIEKDPKNLQVLRDMYNQWPFFRVTLDLVEMVFAKGDPGIAALYD
RLLVSEELWSFGERLRFMYEETKSLLLQVAGHRDLLEGDPYLKQRLRLRDSYITTLNVLQ
AYTLKRIRDPDYHVKLRPHLSKDYMESSNPAAELVKLNPSSDYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggccgctaggaaacttgagaaaatggcttcaattgatgctcagttgaggttgctggca
ccgagtaaggtttctgatgatgacaaacttgttgagtatgatgctttgttgttggaccgc
ttccttgacattcttcaggatttgcatgggaatgatattagagaaacggttcaagactgc
tacgagctgtctgctgagtatgaaggacaaaataaccctcagaagttggaggaacttggg
aacatgctaactggtcttgatgctggggattctattgtgatttccaaatcatttgctcat
atgcttaatttggccaacttggcagaagaagttcaaattgcctaccgtagaaggattaag
ttattaaagaagggtgattttgctgacgaaaattctgctatcactgagtcagatattgaa
gagaccttcaagaggcttgtgaatcaactgaagaagacccctcaagaaatctttgatgca
ctgaagagccaaactgtagatttggtctttactgctcatcctactcagtctgttcgtaga
tctttgctgcaaaagcatgggaggataagggattgtttgacacagttgtatgctaaagac
ataacaccagacgataagcaggagcttgatgaggctttacaaagagagattcaagctgca
tttcgtacggatgaaattcgaagaacccctcctacaccacaagatgagatgagggcagga
atgagctactttcatgagacaatctggaaaggtgtaccaaagtttttgcgtcgggttgac
acagctctgaagaacattggcataaatgaacgtgtgccatataatgcccctgttattcaa
ttttcttcttggatgggaggagatcgtgatggtaacccaagggtaacaccagaagttaca
agggatgtgtgtttgctggctagaatgatggctgctaatatgtacttctctcagattgag
gatctcatgtttgagttgtctatgtggcgctgcaatgatgagctacgtggtcgttctgat
gaactccttagctcctcaaagagagatgcaaaacattatattgagttttggaaacagatt
cccccaaatgagccatatcgtgttattctcagtgatgtaagggacaaattatataataca
cgtgaacgtgctcgacagttgttagccaatggaagctctgaaatccttgaggagactacc
ttcacaaatgttgaacagttcctggagcctcttgaattatgttatagatcactgtgtgca
tgcggtgaccaaccaatagctgatggaagccttcttgatttcttgcgtcaagtttccacc
tttgggctttcacttgtaagacttgatatccgtcaagaatcagatcggcacactgatgtt
atggatgctattacaaaccacttggagattggatcttatcgagaatggtctgaggaacgc
aggcaggaatggctgctatctgagctcagtggaaagcgccctctcttcggcccagatctt
cctaaaacagaagaaattgctgatgtattggaaactttccatgtcatttcagaacttcct
tcagacagctttggtgcctatatcatctcgatggcaacagccccatctgatgtgcttgct
gtagaacttttacaacgtgaatgccatgtgaggaatccattaagggttgtaccattgttt
gaaaagcttgctgatcttgaggctgctcctgctgctgtagcccgcctattctctatagat
tggtacagagaccgtatcaatgggaaacaagaagttatgatagggtactcagactctgga
aaggatgctggtcgtctctctgcagcatgggcactgtacaaggcacaagaagagctcata
agggttgcaaaagagtttggtgttaagcttacaatgttccatggcagaggagggactgtg
ggaagaggaggaggccccactcatcttgctatattatctcagccaccagaaactattcat
ggctcacttcgggtaacagtgcaaggtgaagttattgaacagtcatttggagaggagcac
ttgtgcttcagaacacttcagcgctttgctgctgctacacttgagcatggaatgcaccct
cctgtggcaccaaaaccagaatggcgtgccctaatggatgagatggctgtaattgctaca
gaggagtatcgctccattgttttccaggaaccccgttttgttgagtacttccgatgtgca
actcctgaattggagtatggaagaatgaacattggcagtcgtccatcaaaacgaaagcca
agtggaggaattgaatcactccgcgcaatcccttggatctttgcttggactcagacaagg
tttcatctgcctgtatggcttggctttggggcggcatttaggcatgtaattgagaaggat
ccaaagaatcttcaagtgcttcgagatatgtataatcaatggcctttcttcagggtcacc
cttgacttggttgagatggtgttcgccaagggagaccctgggattgcagccctttatgac
aggctcctagtctcagaagaactgtggtcatttggtgagcgattaaggtttatgtatgaa
gaaaccaagagccttctcctccaggttgctggacacagagatctcctagaaggagatcca
tacttgaagcaaagacttcggcttcgggattcgtacatcacaaccctcaatgtcttgcaa
gcctacacattgaagcgaatccgtgatccagactaccatgtgaagctgaggccacatctg
tccaaagactacatggaatcaagcaatccagcagctgagctcgtgaaactcaacccttca
agtgactatgctcctggtctggaggatacccttattttgacaatgaagggtatagctgct
ggcatgcaaaacactggttaa

DBGET integrated database retrieval system