KEGG   Cajanus cajan (pigeon pea): 109792863Help
Entry
109792863         CDS       T04868                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00020  Citrate cycle (TCA cycle)
ccaj00620  Pyruvate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
Module
ccaj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109792863
   00020 Citrate cycle (TCA cycle)
    109792863
   00620 Pyruvate metabolism
    109792863
Enzymes [BR:ccaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     109792863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 109792863
NCBI-ProteinID: XP_020207904
LinkDB All DBs
Position
2
AA seq 464 aa AA seqDB search
MAHLLQTPFISSSSSPALRRAPTLRRKATAPLVVRAKIREIFMPALSSTMTEGKIVSWTK
SEGDKLSKGDSVVVVESDKADMDVETFYDGYLAAIVVEEGGVAAVGSPIAFLAESEDEIP
QAKSKASSSSSASAPAPAPAPAPAPAPVESQPEKVAAPVSTAAAAAPVVASSHPASEGGK
RIVASPYAKKLAKELKVELGRIVGTGPMGRIVAKDVEAFAAAGNVAAAAAPGKSAVPAGV
DLGSVVPFTTMQNAVSRNMVESLAVPTFRVGYTITTDALDALYKKIKLKGVTMTALLAKA
TALALIRHPVMNSSCRDGNSFTYNSSINVAVAVATDGGLITPVLQDADKIDVYSLSRKWK
ELVDKARAKQLQPHEYSTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQPTVVATKD
GRIGMKNQMQVNVTADHRVIYGADVASFLQTLSKIIEDPKDLTF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccttctccaaactcccttcatttcctcctcctcctcccccgcgctccgccgc
gcccccactctccgccgcaaagccaccgccccgctcgtcgttcgggccaagatccgggag
attttcatgccggcgctcagctccaccatgacagagggcaaaatcgtctcctggaccaaa
tccgagggtgacaagctctccaagggcgacagcgtcgtcgtcgtcgagtccgacaaggcc
gacatggacgtcgagaccttctacgacggctacctcgccgccatcgttgtcgaggagggc
ggagtcgccgccgtcggatcccccatcgccttcctcgccgagtccgaggacgagattcct
caggccaagtccaaagcctcctcatcctcttccgcgtccgcacctgctcctgcacctgca
cctgcacctgcaccggcgccggtggaatctcaaccggagaaggttgcggcgccagtctcg
acggcggctgcggctgctccggtggttgcgtccagtcatcctgcttcggagggagggaag
aggattgtggcgtcgccttatgcgaagaagctcgccaaggagttgaaggtggagttgggg
aggattgtggggactggaccgatggggaggattgtggctaaagatgttgaggcatttgca
gctgcaggtaatgttgcagcagcggcggcaccagggaagagtgcagtgcctgctggggtg
gacttgggatctgtagtgcctttcaccacaatgcaaaatgctgtgagtagaaacatggtg
gagagtttggcagttcccactttcagagttggttacaccatcaccacagatgcacttgat
gccttgtacaaaaagatcaagttaaagggagttacaatgacagcattgcttgccaaggct
actgcacttgcgctgattagacaccctgttatgaactctagttgtagagatggtaatagc
tttacatataatagcagcatcaatgttgcagttgctgtggctacagacggtggactgatt
acaccagtgcttcaagatgctgataagattgatgtatattcattgtcaagaaagtggaag
gagttggttgataaggcccgtgccaagcagctccaacctcatgaatacagcactggtact
ttcactctttcgaatctgggaatgtttggcgttgatcgctttgatgctattctgccacct
ggaactggagcaataatggctgttggagcatcgcagccaactgttgtggctaccaaggat
ggtcgcattggcatgaagaaccaaatgcaggtcaatgttacagcagatcatcgagtaatc
tatggtgccgatgtagcttcattcttgcaaaccctgtcaaagattattgaggaccccaaa
gatcttactttctag

DBGET integrated database retrieval system