KEGG   Cajanus cajan (pigeon pea): 109792993Help
Entry
109792993         CDS       T04868                                 

Definition
(RefSeq) fanconi-associated nuclease 1 homolog isoform X1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccaj03400]
    109792993
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     109792993
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     109792993
DNA repair and recombination proteins [BR:ccaj03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     109792993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC HIRAN zf-WRNIP1_ubi RNF220 Rad50_zn_hook
Motif
Other DBs
NCBI-GeneID: 109792993
NCBI-ProteinID: XP_020208043
LinkDB All DBs
Position
Unknown
AA seq 902 aa AA seqDB search
MVLTGRESLIRLIGKRRRFLPNRHSILSDPNPNPNPNPIQAAEPQNDDVQCPVCGHNLPG
DNRHINSHLDACLSQPTPITATKRKLSQRTLLQLNFTLSNSKPKFENLSDDGNTAPVPPS
PDSEEEELKHEVTENHEAQLDSTVSATSSSSPLNSGVQDDYEPRELGTTLETFIVGRRYA
DHREEIRVGTSIALLRDPRNVKDPNAIKVVSADSACCKSLGFLPRELAQHLSPLIDNYGL
EFQGHVTSVPKHSLDIVSVQIMYHRTSDGETKSADEIFKSLWKNAQRVVEFASRNPPSSV
KYQLNFCVMLQEVLRNNIHLLTEEEKSYMESFTLLSNDSQRLFIRLYPRKGPWFRMSSIS
YPEILDTQKAVKGLAEKGYIDFIEDANQLCDSNVNDILNILSVSELREIWCILLKKSGGH
VMKKQHLISSLSTDADILWPQLSTMILDRIGSCIMISSKAESLMWRIERLFFLNGEQDLS
SFLLVDMGKIKYPAYNCLISEPIFSNCRNLLSYEEAIEVAQIMDEALDANKIDVVLRCIK
IAESCISTDLPIQYSTSESVSSIRHLFTASWVYSKVVTVGISFLEQERRYTNAINLLKLL
LNIFTCDVRRGYWALRLSIDLEHLGCIDESLQIAENGLLDTWIRAGSRMALQRRVLRLGK
PPRRWKVPSFSRSALQKIPEVFIQGRPLNSELGAKNRYYDEEGKQCGVEELALHYYAGAG
GGWQGIHAESGIWLTIFGLLMWDVIYADVPNVFYTRFQNAPLDFGTDGFYTARKSCIESH
LQQIRDGMAEEFIIKSWETHVGTACRGVNWDCHSLDELRAVVTCVGGTCLASFCQLLAQD
YRSWSSGMPDLLLWRFHGDYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVK
PL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgaccggcagagaaagcctgattcgattaatcggcaaacggaggcgcttcctt
cccaatcgccactccatcctctccgatcctaaccctaaccctaaccctaaccctattcag
gccgcggagcctcaaaacgacgacgtgcagtgccctgtttgcggccacaaccttcccggc
gataaccgccacatcaactctcatctcgatgcgtgtctctcccaaccgacaccaattact
gcaactaagcgaaagctctcccaacgcacactacttcagctaaacttcactctatcaaat
tccaaacctaaattcgagaatctcagtgatgacggtaacactgccccggtgccgccttct
cccgattccgaagaagaagaattgaaacatgaagtcactgaaaatcacgaggctcaactt
gattctactgttagtgccacctcatcttcctcgcccttgaacagtggggtgcaggatgat
tacgagccacgcgaacttggcacgacgcttgaaactttcatcgttggccggagatatgct
gatcaccgagaagaaatacgtgttggcacctcgatcgctcttttgagggaccctcgaaat
gttaaggaccccaatgccatcaaggttgtttctgcggattctgcttgctgtaagtcattg
ggttttctcccccgcgagctcgcccagcatctatctcctcttatcgacaactatggcctt
gaatttcaggggcatgtcacttctgttccaaaacattcccttgatattgtttcagtacag
attatgtaccacagaacatcagatggtgaaaccaagtctgctgatgagatctttaaaagc
ttatggaaaaatgcgcaacgtgttgttgaatttgcaagcaggaatcctccttcatctgta
aagtatcagctgaacttttgtgttatgctacaggaagtgttaagaaataatatccacctt
cttactgaagaagaaaaatcctatatggaatcattcactttactctcaaatgacagtcag
aggctttttatccgtctataccctagaaaaggaccttggtttcgcatgtctagtatatca
tatcctgaaatattggatactcaaaaggcagtcaagggacttgctgagaaaggatacata
gattttattgaagatgcaaatcaactatgtgatagcaatgtgaacgatatcttgaatatc
ctcagtgtctctgagttgcgtgaaatttggtgcattttacttaaaaagagtggcggtcat
gtgatgaagaagcagcatctgatttcatctctttctacagatgctgacatactatggcca
caactatcaactatgattttggatagaattggttcctgtattatgatttcttcaaaagct
gaatctcttatgtggcgtattgagagacttttcttcttaaatggagaacaggatctttcg
tcctttctacttgttgatatgggaaaaatcaagtatccagcttataactgcttaatatca
gaaccaattttctcaaattgcaggaatctgctctcttatgaagaggccatcgaagtggcg
caaattatggatgaagctcttgatgcaaacaaaattgatgtggtgttaaggtgcataaag
atagctgaatcctgtatatctactgatttgcccatccagtactcaacttctgaatcagtt
tcttcaattcgtcacttatttacagcatcatgggtatactccaaagtggtcacagtaggg
atttccttccttgagcaagagcgtaggtacactaatgcaattaacttactcaagttgctg
ctaaatattttcacttgtgatgttcgaagaggatattgggcactgaggttgtcgattgac
ttggaacacttgggctgcattgatgagagccttcaaatagctgaaaatgggttgctggat
acatggatacgtgctggttcaagaatggcactgcaaaggcgagttcttcgcttgggcaaa
ccaccaaggcgatggaaagttcctagtttttctagatctgctctgcagaaaatccctgag
gtttttattcaagggagaccattgaattctgaattgggagcaaagaacaggtactacgat
gaagaggggaagcaatgtggagtggaagagcttgctttgcattactatgctggggccgga
ggtggatggcaaggcattcatgcagagagtggcatatggttgaccatttttgggcttctt
atgtgggatgtcatatatgccgatgtgccaaatgtcttctatactagatttcagaatgct
cctttagattttggcaccgatggcttttatactgcaagaaagagttgcatagaatcccat
ctgcaacaaattcgtgatggcatggctgaggagtttattattaagtcatgggaaacacat
gtaggaacagcatgcagaggagttaattgggactgccattccttagatgagcttcgcgct
gttgttacttgtgttgggggtacttgtttggcatctttttgccaacttctggcacaagac
tatcggagctggtctagtggaatgccagatttgctgctatggcgtttccatggagattac
agtggtgaagccaagcttgttgaagtgaaaggccctagggaccgactctcagagcagcag
agagcatggttattgcttcttatggattgtggatttatgattgaggtttgtaaagtgaaa
cctttgtag

DBGET integrated database retrieval system