KEGG   Cajanus cajan (pigeon pea): 109793046Help
Entry
109793046         CDS       T04868                                 

Definition
(RefSeq) dihydrolipoyl dehydrogenase 2, chloroplastic-like isoform X1
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00020  Citrate cycle (TCA cycle)
ccaj00260  Glycine, serine and threonine metabolism
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00310  Lysine degradation
ccaj00380  Tryptophan metabolism
ccaj00620  Pyruvate metabolism
ccaj00630  Glyoxylate and dicarboxylate metabolism
ccaj00640  Propanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
Module
ccaj_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ccaj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
ccaj_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109793046
   00020 Citrate cycle (TCA cycle)
    109793046
   00620 Pyruvate metabolism
    109793046
   00630 Glyoxylate and dicarboxylate metabolism
    109793046
   00640 Propanoate metabolism
    109793046
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109793046
   00280 Valine, leucine and isoleucine degradation
    109793046
   00310 Lysine degradation
    109793046
   00380 Tryptophan metabolism
    109793046
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109793046
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     109793046
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   109793046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_binding_2 GIDA FAD_oxidored K_oxygenase Pyr_redox_3 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 109793046
NCBI-ProteinID: XP_020208106
LinkDB All DBs
Position
Unknown
AA seq 558 aa AA seqDB search
MQSSISLSSSYAPTVSFPFSVATLAPSNLRFCALRRQAFTPSSIVHRHTRRRAHSAAVSA
ALSDNGTAPKSFDYDLLIIGAGVGGHGAALHAVEKGLKTAIVEGDVVGGTCVNRGCVPSK
ALLAVSGRMRELRNDHHLKSLGLQVSAAGYDRQAVADHANNLASKIRGNLTNSMKALGVD
ILTGFGTILGPQKAKVGSSNKVVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLET
VPDWIAIVGSGYIGLEFSDVYTALGSEVTFVEALDQLMPGFDPEISKLAQRVLINPRNID
YHTGVFASKITPARDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTQGLGLENIDV
VTQRGFVPVDERMRVIDSNGNLVPHLFCIGDANGKMMLAHAASAQGISVVEQVTGRDHVI
NHLSIPAACFTHPEISMVGLTEPQAREKGEKEGFEVSVAKTSFKANTKALAENEGEGLAK
LIYRPDNGDILGVHIFGLHAADLIHEASNAIALGTRIQDIKFAVHAHPTLSEVLDELFKS
AKQVKEHASGPVNEPVTV
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcatccatttcgctctcttcctcatacgctcccaccgtttcttttcccttctcc
gtcgccactctcgcgccttcaaatctccgcttctgcgctctcaggcgccaggcattcact
ccctcttctatcgtccaccgccacacccgccgccgcgcacactccgccgcagtgtccgcc
gcgctttccgacaacggcaccgctcccaaatccttcgactacgacttgctcatcatcggc
gccggcgttggcggccacggcgccgcgctccacgccgtcgagaagggtttgaaaacggcg
attgttgagggagacgtggttggagggacgtgtgtgaacagaggctgtgttccttctaag
gctcttttggctgtgagtggtcgtatgcgggagctgcggaatgatcatcacttgaagtcg
ctgggtttgcaggtttctgctgctgggtatgacagacaggctgttgctgaccatgctaat
aatcttgcttcgaaaatccgtggcaacttgaccaactccatgaaagcacttggagtggac
atactcactggttttggaactattttgggtcctcaaaaggcgaaagttggctcttccaac
aaagtggtgactgcaaaagacatcatcattgccactggttccgttccttttgttcccaag
ggcattgaagttgatgggaagactgtgattaccagtgaccatgcactcaaactggagact
gttccagattggatagcaattgtaggaagtggttatataggccttgaattcagtgacgta
tatacagctcttggaagtgaggttacttttgttgaagctttagatcagctcatgcctgga
tttgatcctgaaattagcaagttggctcagagggttctcattaacccccggaatattgac
taccatactggtgtttttgcatccaagatcactcctgcaagagatggaaaacctgtcaca
attgagctcattgatgcaaagaccaaggaaccaaaagacactttagaggtggatgctgca
ctaatagcaactggaagggctccattcacacaaggtcttggattggagaatattgatgtt
gtaacacagcgtggtttcgttcctgtggatgagcgcatgcgagtaattgattcaaatgga
aacctggtccctcatttattttgtattggtgatgcaaatggcaaaatgatgcttgctcat
gctgccagcgcacaaggaatttcagtggtcgaacaagtcactggaagagatcatgtgatc
aatcatttaagcataccagctgcttgtttcactcatcctgaaatcagcatggttggattg
acagagcctcaagcaagggagaaaggtgaaaaggagggttttgaagtaagtgttgccaaa
acaagttttaaagctaacacaaaggccttagcagaaaacgaaggcgagggtcttgccaag
ttgatatatagacccgacaatggagatatattaggagttcatatttttgggttgcatgca
gctgatctcatccatgaggcatccaatgcaatagcattaggaacacgtattcaggatata
aaatttgcggttcatgctcatccaactttgtctgaggtgcttgatgaactgtttaaatca
gcaaaacaggttaaagaacatgcttctggcccagtgaatgaaccagtaactgtttaa

KEGG   Cajanus cajan (pigeon pea): 109808086Help
Entry
109808086         CDS       T04868                                 

Definition
(RefSeq) dihydrolipoyl dehydrogenase 2, chloroplastic isoform X1
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00020  Citrate cycle (TCA cycle)
ccaj00260  Glycine, serine and threonine metabolism
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00310  Lysine degradation
ccaj00380  Tryptophan metabolism
ccaj00620  Pyruvate metabolism
ccaj00630  Glyoxylate and dicarboxylate metabolism
ccaj00640  Propanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
Module
ccaj_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ccaj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
ccaj_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109808086
   00020 Citrate cycle (TCA cycle)
    109808086
   00620 Pyruvate metabolism
    109808086
   00630 Glyoxylate and dicarboxylate metabolism
    109808086
   00640 Propanoate metabolism
    109808086
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109808086
   00280 Valine, leucine and isoleucine degradation
    109808086
   00310 Lysine degradation
    109808086
   00380 Tryptophan metabolism
    109808086
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109808086
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     109808086
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   109808086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_binding_2 GIDA FAD_oxidored K_oxygenase Pyr_redox_3 Thi4 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 109808086
NCBI-ProteinID: XP_020226504
LinkDB All DBs
Position
11
AA seq 627 aa AA seqDB search
MHSSLSLSFSATSSSAATVSRSRYSFHAPAAVPLNLRFCGLRREAFGSGLAASLNRNLPR
RPHSAAVSAALSNNGSTPKSFDYDLLIIGAGVGGHGAALHAVEKGLKTAIVEGDVVGGTC
VNRGCVPSKALLAVSGRMRELKSDHHLKSFGLQVSAAGYDRQGVADHANNLASKIRNNLT
NSMKALGVDILTGFGTILGPQKVKVGSSNKIVTAKDIIIATGSVPFVPKGIEIDGKTVIT
SDHALKLESVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEISKLAQR
VLINPRNIDYHTGVFATKITPARDGKPVLIELIDAKTKEPKDTLEVDAALIATGRAPFTQ
GLGLENIDVVTQRGFVPVDERMRVIDANGKLVPHLYCIGDANGKMMLAHAASAQGISVVE
QVTGKDHVLNHLSIPAACFTHPEISMVGLTEPQAREKGEKEGFEVSVAKTSFKANTKALA
ENEGEGLAKLIYRPDNGEILGVHIFGLHAADLIHEASNAIALGTRIQDIKFAVHAHPTLS
EVLDELFKSAKVKARASSPGLPKYYASSGGRHEHIQNPVKEGNRLREINKGLIMDNRRRL
HVLVSFLLGILSACQRCLSSLLLHFLN
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgcactcctcgctctctctctcgttctccgccacctcctcctccgccgccaccgtctcc
agatcacgctactccttccacgcccccgccgccgtgcctctcaatctccgcttctgcggc
ttgcggcgtgaggcttttggctcaggtctcgccgcctctctcaaccgcaacctccctcgc
cgccctcactccgccgcagtctcggccgcgctctccaacaatggcagcactcccaaatcc
ttcgactacgatttgttgatcatcggcgccggcgttggcggccatggcgcagcgcttcat
gccgttgagaagggtttgaaaacagcgattgtggaaggagatgtggtgggcgggacgtgt
gtgaacagaggctgtgttccttcgaaagctcttttggccgtgagtggtcgtatgcgagaa
ctaaagagcgatcatcacttgaagtcctttggcttacaggtttctgctgcagggtatgac
agacaaggggtcgctgatcatgctaataatcttgcttcgaaaatccgtaataacttgacc
aactcgatgaaagcgcttggagtggacatacttaccggttttgggactattttgggtcct
caaaaggtgaaagttggctcttctaacaaaatagtaactgcaaaagatatcatcattgct
actggttctgttccttttgttcctaagggaattgaaattgacgggaagactgtgattacc
agtgaccatgcactcaaactggagtctgttcctgattggatagcaattgtaggaagtgga
tatattggccttgaattcagtgatgtatatacagcacttggaagtgaggttacttttata
gaagctttagatcaacttatgcctggttttgatcctgaaattagcaagttggctcagagg
gttcttataaatccccggaatattgactatcatactggagtttttgcaaccaagatcacg
cctgcaagggatggaaaacctgtcttgattgaacttattgatgcaaaaaccaaggagcca
aaagacactctggaggtggatgctgcactaatagctactggaagggctccattcacacaa
ggtcttggattggagaatattgatgtggtaacgcagcgtggttttgttcctgtggatgag
cgcatgcgagtaattgatgcaaatggaaagctggtgcctcatttatactgtattggtgat
gcaaatggcaagatgatgcttgctcatgctgccagtgcacaaggaatttcagtggttgaa
caagtcactggaaaagatcacgtgctcaatcatttaagtatcccagctgcttgtttcact
catcctgaaatcagcatggttggattgacagagcctcaagcaagggagaaaggtgaaaaa
gaggggtttgaagtaagtgttgccaaaacaagttttaaagccaacacaaaggccctagca
gaaaatgaaggagaggggcttgccaagttgatatacagacctgacaatggagagatactg
ggggttcatatttttggtttgcatgcagcagatcttatccatgaagcatccaacgcaata
gcattagggacgcgtattcaggacatcaaatttgcagttcatgcacatccaactttgtcc
gaggttcttgatgaactattcaaatcagcaaaggttaaagcgcgagcttctagcccagga
cttccaaaatattatgcatcttcaggaggaagacacgaacatattcagaatcctgtaaaa
gaggggaaccgtttgagggagatcaataaaggcctaataatggataaccgccgaagatta
catgtactggtttcttttctacttggtattcttagtgcctgtcaaagatgcttaagttca
ttactattgcattttttaaactag

KEGG   Cajanus cajan (pigeon pea): 109811008Help
Entry
109811008         CDS       T04868                                 

Definition
(RefSeq) leghemoglobin reductase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00020  Citrate cycle (TCA cycle)
ccaj00260  Glycine, serine and threonine metabolism
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00310  Lysine degradation
ccaj00380  Tryptophan metabolism
ccaj00620  Pyruvate metabolism
ccaj00630  Glyoxylate and dicarboxylate metabolism
ccaj00640  Propanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
Module
ccaj_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ccaj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
ccaj_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109811008
   00020 Citrate cycle (TCA cycle)
    109811008
   00620 Pyruvate metabolism
    109811008
   00630 Glyoxylate and dicarboxylate metabolism
    109811008
   00640 Propanoate metabolism
    109811008
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109811008
   00280 Valine, leucine and isoleucine degradation
    109811008
   00310 Lysine degradation
    109811008
   00380 Tryptophan metabolism
    109811008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109811008
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     109811008
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   109811008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA NAD_binding_8 FAD_binding_2 FAD_binding_3 AlaDh_PNT_C HI0933_like Thi4 3HCDH_N UDPG_MGDP_dh_N K_oxygenase DAO Lycopene_cycl Amino_oxidase
Motif
Other DBs
NCBI-GeneID: 109811008
NCBI-ProteinID: XP_020230223
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MAMANLARRKGYAVVLSSRSSFCLTRWRGFASGSDENDVVVIGGGPRGXXXAIKAAQLGL
KTTCIEKRGTLGGTCLNVGCIPSKALLHSSHMYHEAKHSFANHGVKLSSVEVDLPAMMAQ
KDKAVSNLTKGIEGLFKKNKVNYVKGYGKFASPSEVSVDTIDGGNTVVKGKHIIIATGSD
VKSLPGVTIDEKKIVSSTGALALTEIPKRLIVIGAGYIGLEMGSVWGRLGSEITVVEFAP
DIVPTMDSEVRKQFQRSLEKQGMKFKLKTKVVGVDTSGDGVKLTVEPSAGGDQTTLEADV
VLVSAGRTPFTAGLGLDKIGVETDKVGRILVNERFATNVSGVYAIGDVIPGPMLAHKAEE
DGVACVEYIAGKVGHVDYDKVPGVVYTTPEVASVGKTEEQVKALGVEYRVGKFPFLANSR
AKAIDNAEGLVKILAEKETDKILGVHIMAPNAGELIHEAAIALQYDASSEDIARVCHAHP
TMSEAVKEAAMATYDKPIHI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcaaatttggctcgacggaagggttacgctgtcgttttgtcatcgaggtcg
tcgttttgcctcacgaggtggaggggattcgcgtccggatctgacgaaaacgacgttgtc
gtcatcggcggcgggccccgcggnnnnnnnnccgccattaaagcggcgcagttaggtctc
aaaacgacttgcatcgaaaagcgtggaactctcggcggcacctgtctcaacgtcggatgc
atcccttccaaggcgcttttgcattcttcccacatgtaccatgaggctaaacattcattt
gccaaccatggggtcaagctttcatctgttgaggttgatttgccggctatgatggcccaa
aaagataaagctgtttctaatcttaccaagggtattgaaggtctattcaagaaaaacaag
gtaaactatgtcaaaggatacggcaaatttgcttcgccatctgaagtctctgtggacacc
attgatggtggaaatactgttgtcaaaggcaagcatattataattgccactggttcggat
gtgaaatctctacctggcgtcaccattgatgaaaagaaaattgtatcatcaacaggggct
cttgctttgactgaaatccctaagagactcatagtcatcggggcaggctacattgggcta
gaaatggggtcagtatggggcagacttggctccgagataacagttgttgagtttgcaccg
gatattgttccaaccatggattcggaggtccgtaagcagtttcagcgttctcttgagaag
caaggcatgaaattcaagctgaagacgaaggtggttggagttgatacttccggggatggt
gtgaagctgactgttgaaccttcagctggtggtgatcagactacattagaagcagatgtt
gtccttgtatctgctggtaggactcctttcactgctggacttgggttagacaagatagga
gttgaaactgacaaggtaggacggattttggtgaatgaaagatttgccacaaatgtctct
ggtgtttatgcgattggagatgtaattccaggcccaatgttggcacacaaggcagaggaa
gatggtgtcgcttgcgtggagtacatagctggtaaggttggtcatgtggactatgacaaa
gtccctggtgttgtctatacaacccccgaggttgcatctgttggaaagacagaggagcag
gtgaaggcgctcggagttgaataccgtgttggcaagttcccgttcctggctaatagcaga
gccaaggcaattgataatgctgaaggtctggtgaagattttggctgaaaaggagacagac
aagatattgggagtgcatattatggcacccaatgcaggagagctcattcatgaagcagca
atagcattgcagtatgatgcatccagtgaggacatagcacgtgtttgccatgcacatcca
acaatgagtgaggccgtgaaagaagccgcaatggccacttatgacaagcccattcacata
tga

DBGET integrated database retrieval system