KEGG   Cajanus cajan (pigeon pea): 109794099Help
Entry
109794099         CDS       T04868                                 

Definition
(RefSeq) long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic-like
Organism
ccaj  Cajanus cajan (pigeon pea)
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding PPV_E1_C
Motif
Other DBs
NCBI-GeneID: 109794099
NCBI-ProteinID: XP_020209152
LinkDB All DBs
Position
Unknown
AA seq 146 aa AA seqDB search
MASGAINVVRGSRSSVEELLQIYNHSESVALVVDNPEMFNRVANTFYSRTSMRFVVLLWG
EKSDLVGQENKHVPVFTFMEVINLGRESRQALSNTHDAEQRYTYEAINSDNVATIMYTSG
TTGNPKGVMLTHRNLLHQVSLQTYRN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtggagcaatcaatgtggtaagaggctcaaggtcatcagttgaagagctatta
caaatatacaaccactctgaaagtgttgcactagtggtggataaccctgaaatgtttaac
cgggttgcaaacacattttattcaaggactagcatgaggtttgttgttttgctttgggga
gaaaaatcagacctggttggtcaagaaaacaagcacgtgccagtgtttactttcatggaa
gtcataaatttgggacgagagagtcgccaggcattgtctaatactcatgatgctgaacag
cgttatacttatgaagcaataaactctgataacgttgctactatcatgtatacaagtgga
actaccggcaatcccaaaggtgttatgctaacccatcggaatcttctgcatcaggtttca
ttacaaacctaccgtaattaa

KEGG   Cajanus cajan (pigeon pea): 109794309Help
Entry
109794309         CDS       T04868                                 

Definition
(RefSeq) long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic-like
Organism
ccaj  Cajanus cajan (pigeon pea)
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding PPV_E1_C NDUF_B4
Motif
Other DBs
NCBI-GeneID: 109794309
NCBI-ProteinID: XP_020209352
LinkDB All DBs
Position
Unknown
AA seq 108 aa AA seqDB search
MMASGAINVVRGSRSSVEELLQIYNHSESVALVVDNPEMFNRVANTFYSRTSMRFVVLLW
GEKSDLVGQENKHVPVFTFMEVINLGRESRQALSNTHDAGKYQALTKN
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaagtggagcaatcaatgtggtaagaggctcaaggtcatcagttgaagagcta
ttacaaatatacaaccactctgaaagtgttgcactagtggtggataaccctgaaatgttt
aaccgggttgcaaacacattttattcaaggactagcatgaggtttgttgttttgctttgg
ggagaaaaatcagacctggttggtcaagaaaacaagcacgtgccagtgtttactttcatg
gaagtcataaatttgggacgagagagtcgccaggcattgtctaatactcatgatgctggt
aagtatcaggctcttactaagaattag

KEGG   Cajanus cajan (pigeon pea): 109794310Help
Entry
109794310         CDS       T04868                                 

Definition
(RefSeq) long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic-like
Organism
ccaj  Cajanus cajan (pigeon pea)
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding PPV_E1_C
Motif
Other DBs
NCBI-GeneID: 109794310
NCBI-ProteinID: XP_020209353
LinkDB All DBs
Position
Unknown
AA seq 198 aa AA seqDB search
MATTPITCNHTHHALPCFLTRCNSTTITFSRTKYPPSTSLLSQFRVFCQSKLEQAILDFA
EGLRVIGIKPEEKVALFLDNSCRWLVADQGMMASGAINVVRGSRSSVEELLQIYNHSESV
ALVVDNPEMFNRVANTFYSRTSMRFVVLLWGEKSDLVGQENKHVPVFTFMEVINLGRESR
QALSNTHDAGKYQALTKN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaactcctatcacctgcaaccatactcatcatgcacttccctgcttcctcaca
cgctgcaattccactaccatcacattttctcgcacaaaatatcccccttctacttctcta
ctctctcagtttcgcgtattttgccaatccaagttggagcaggcaattttggattttgca
gaaggcttgagagttattgggattaaacctgaagagaaggttgcactttttttggataat
tcatgtcgttggcttgtagcagatcaaggtatgatggcaagtggagcaatcaatgtggta
agaggctcaaggtcatcagttgaagagctattacaaatatacaaccactctgaaagtgtt
gcactagtggtggataaccctgaaatgtttaaccgggttgcaaacacattttattcaagg
actagcatgaggtttgttgttttgctttggggagaaaaatcagacctggttggtcaagaa
aacaagcacgtgccagtgtttactttcatggaagtcataaatttgggacgagagagtcgc
caggcattgtctaatactcatgatgctggtaagtatcaggctcttactaagaattag

KEGG   Cajanus cajan (pigeon pea): 109800221Help
Entry
109800221         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 2-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109800221
   00071 Fatty acid degradation
    109800221
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109800221
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109800221
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109800221
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109800221
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109800221
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109800221
  Exosomal proteins of breast cancer cells
   109800221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109800221
NCBI-ProteinID: XP_020216562
LinkDB All DBs
Position
6
AA seq 661 aa AA seqDB search
MPEVYTVKVEEGRPATDDGKPSVGPVYRSIYAKDGLLELPSDYQSPWDFFRESAKRNPNN
KMLGRRQKTESQVGSYAWLTYQEVYDGAMKMGSAMRSRGVNPGDRCGIYGSNCPEWVIAM
EACNCSAVSYVPLYDTLGPNAVEFIINHAEVSIAFVQEKKIPSILSCLDRCSSNLKTIVS
FGNVSTTQKKEAEDHGTSCFSWGEFLDLGCLHWDLPSKKKTDICTIMYTSGTTGEPKGVI
IKNEAFMSEVLSIDHIIMLTDRVAAEDDVYFSFLPLAHVYDQIMETYCIFKGSSIGFWQG
DVRFLLDDVQALKPTIFCGVPRVFDRIYAGIKNKVSSAGILQSTLFQCAYNYKLKYLEKG
LPQHKAAPLFDRLVFDKTKQALGGRVRILLSGAAPLPRHVEEFMRVTSGSTLSQGYGLTE
SCAGCFTAIGDVYSMTGTVGVPMTTIEARLESVPEMGYDALSNVARGEICLRGNTLFSGY
HKREDLTKEVMVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYIAVENIENKYLQC
PLITTIWVYGNSFESFLVAVVVPERKAIEDWALQHNLTDDFKSLCDNLKARKYILDELNS
TGQKHQLKGFEQLKAIHLEPNPFDMERDLITPTFKLKRPQLLKYYKDHIDHLYKEAKGAM
V
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggtttacactgtgaaggttgaggagggaaggcctgcaactgatgatggaaag
ccatctgtaggacctgtctataggagcatttatgccaaagatggtctcttggagttgcct
tctgattatcagtctccttgggatttcttcagggaatcagctaagaggaaccccaacaac
aaaatgctgggtaggcgtcaaaaaaccgaatctcaggtgggttcctatgcatggctcacg
tatcaagaggtttatgatggtgccatgaaaatgggttctgccatgaggagccgtggtgtc
aatcctggagatcgttgtggcatatatgggtctaactgccctgaatgggtcattgcaatg
gaggcttgcaattgcagtgcagtgtcatatgttccattatatgacacgcttggacctaat
gcagtggaatttatcataaatcatgctgaagtctcaattgcgtttgtacaggagaaaaag
atcccatcaattttgtcatgtcttgatcggtgttcctcaaatcttaaaactattgtaagc
tttggaaatgtttcaaccacacaaaagaaggaagctgaggatcatggcacatcctgcttc
tcatggggagagtttctcgatctggggtgtctgcattgggatctaccatcaaaaaagaag
actgatatttgcacaataatgtacacaagtggaacaactggagaacccaaaggtgtcatt
attaagaatgaggctttcatgtctgaagtattgtctattgaccacataattatgttaaca
gacagagtggcagctgaagacgatgtgtacttctcctttcttcctcttgctcatgtatat
gaccaaataatggagacctattgcatcttcaagggttcatcaataggattttggcaaggc
gatgtcaggttcttgctggatgatgttcaggcactaaaaccaaccatattttgtggtgtt
cctagagtttttgaccgtatttatgctggtatcaaaaacaaagtttcttccgcaggaata
ctgcagagtacattgtttcagtgtgcttacaactacaagttaaaatatctggagaagggt
cttccacaacacaaagcagcacctctgttcgatagacttgtgtttgataagacaaaacaa
gcactaggtgggcgtgttcgtatcttgttatcaggagctgcacctttgcctaggcatgtg
gaagagtttatgagggtcactagcggatctacattatcacaaggatatggtcttacagaa
agttgtgccgggtgtttcacggcaataggtgatgtgtattctatgacaggaacagttgga
gtccccatgacaacaattgaggctaggcttgaatctgtgccagagatgggatatgatgcc
ctctccaatgtagcccgtggagaaatttgtctgagaggaaataccttgttctctggttat
cacaagcgtgaagatcttaccaaagaggttatggttgatggttggtttcatacaggtgac
attggagagtggcaaccaaatggagccatgaaaattattgataggaaaaagaatatcttt
aaattgtctcaaggagaatacattgcagtagagaacattgaaaacaagtatttgcaatgc
cctcttataacaacgatttgggtgtatggtaacagctttgagtcattcttggtggctgtt
gtggtcccagaaaggaaggccattgaggattgggcactacagcacaatttgactgatgat
ttcaaatctttatgtgataatctaaaagcaagaaagtacattttggatgaactcaatagt
actggccagaaacaccaacttaaaggatttgagcagctaaaagccattcatctggaacca
aatcccttcgacatggagagagacttaataactccaacatttaaattgaaaagaccacag
ttgctcaagtactataaggatcatattgatcatctgtacaaggaagcaaagggagcaatg
gtgtga

KEGG   Cajanus cajan (pigeon pea): 109800629Help
Entry
109800629         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109800629
   00071 Fatty acid degradation
    109800629
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109800629
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109800629
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109800629
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109800629
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109800629
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109800629
  Exosomal proteins of breast cancer cells
   109800629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109800629
NCBI-ProteinID: XP_020217010
LinkDB All DBs
Position
6
AA seq 435 aa AA seqDB search
MYTSGTTGDPKGVLISNEGIITLLAGVKRLLESVNEQLTEKDVYISYLPLAHIFDRVIEE
AFIWHGASIGFWRGDVKLLIEDIGELKPTIFCAVPRVLDRVYSGLTQKISSGGFLKKTLF
NFAYSYKLNNMKKGITHGEASPLLDKIVFDKIKQGLGGRVRLILSGAAPLSAHVEGYLRV
VTCAHVLQGYGLTETCAGTFVSLPNEMDMLGTVGPPVPNVDVCLESVPEMGYDALASTPR
GEICVKGKTLFSGYYKREDLTKEVMIDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLAQGE
YVAVENLENIYSQVSCVESIWIYGNSFEAFLVAVVNPSKQALEHWAQENGISTDFDSLCE
DPRAKRYIVEELSKIAKEKKLKGFEFIKGVHLDPVPFDMERDLITPTYKKKRPQMLKYYQ
NAIDNLYKSGNKPRA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtatactagtggaactactggtgaccccaagggagtgttgatatcaaatgagggtatt
attactctcttagctggggttaagcgactgttggagagtgtcaatgaacaattgactgag
aaagatgtatacatatcatacctccctcttgcacatatttttgatagggtcattgaggag
gcattcatttggcatggtgcttcgataggtttctggcgtggggatgtcaaattgttaatt
gaagatattggggaacttaaaccaactattttctgtgctgttccccgtgtgcttgataga
gtatactcgggtttgacacaaaagatttcttccggtggcttcttaaagaagacattattc
aacttcgcatattcatataagctgaataacatgaagaaagggattacacatggagaggca
tctccacttcttgataaaattgtgtttgataagataaagcaaggtttagggggtagggta
cgtcttattttgtctggagcagcacctttatctgcacatgtggaaggttacttacgggtt
gtgacttgtgctcatgtcctacaaggatacggtctgacggaaacttgcgcgggaaccttt
gtctctttaccaaatgaaatggatatgcttggaacagtgggccctcctgtaccaaatgtg
gacgtgtgtctggaatctgttcctgaaatggggtacgatgccctagccagcacaccaaga
ggagaaatttgtgtaaaaggaaaaaccttgttttcagggtattacaaacgtgaagacctc
accaaagaggttatgatcgatggatggttccatacaggggatattggagagtggcaaccc
aatggaagcatgaaaattattgatcgaaagaagaatatatttaagcttgcacaaggagaa
tatgttgcagttgaaaacctggagaatatttacagtcaagtttcttgtgttgaatctata
tggatttatggaaacagtttcgaggctttccttgttgctgttgttaaccctagtaagcaa
gcgcttgaacattgggcacaagaaaatggtatatccacggacttcgattctctctgtgaa
gatcctagagcaaaacgttacatagttgaagagctctcaaagatcgcaaaggaaaagaag
ttgaaaggttttgagtttataaaaggagttcaccttgacccagttccatttgacatggaa
cgtgaccttatcactccaacatataagaagaagaggcctcagatgcttaaatactatcag
aatgccattgacaacttgtacaagagtggaaataaaccccgtgcctga

KEGG   Cajanus cajan (pigeon pea): 109801554Help
Entry
109801554         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 2-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109801554
   00071 Fatty acid degradation
    109801554
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109801554
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109801554
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109801554
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109801554
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109801554
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109801554
  Exosomal proteins of breast cancer cells
   109801554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109801554
NCBI-ProteinID: XP_020218242
LinkDB All DBs
Position
6
AA seq 659 aa AA seqDB search
MAGVYTVKVEEARPATPEKPSAGPAYRCIFAKDALTNLPSLFESPWDFFRDTKTRCPSNP
MLGRRKKTGSKVDPYEWITYQEAYDAAIQIGSAMKSRGVNPGDRCGIYGSNCPEWIIAME
ACNGYAVTYVPLYDTLGPNAVEFIINHAEVSIAFVQDNKIPSVLSCLDRCSNLKTIVSFG
NVSSSQKKEAEELGASCFTWGEFLQLGNTDFDVPLKKKTNICTIMYTSGTTGEPKGVIIK
NEAFMTQVLSIDQILYITDVVGTEDDVYFSFLPLAHIYDQIMETYCIYKGSSIGFWQGDV
RFLMEDIQALKPTLFCGVPRVYDRVYAGISSQISSGGALRSTLFQYAYNYKLGYLEKGLP
QDKAAPLFDRLVFDKIRQALGGRVRLLLSGAAPLPRQVEEFLRVTFGANMSQGYGLTESC
GGCFTAISNVFSMMGTIGVPMTTIEARLESVPEMGYDALSSEARGEICLRGNTLFSGYHK
RQDLTEEVLVDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENIENKYLQCPL
VTSIWVYGNSFEPFLVAVVVPERNALEDWAMKHNSNVDFKSLCGNLKARKYILDELNRTG
QKHQLRGFEMLKAVHLEPIPFDMERDLVTPTFKLKRSQLLKHYKDYIDQLYKEAKAQKV
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggtttacactgtgaaggtggaggaagcaaggccagcaactcctgaaaagcca
tcagcaggccctgcctacagatgcatttttgccaaagatgctttgacaaacttgccttct
ctttttgaatctccatgggacttcttcagggacacgaaaacgaggtgccccagcaacccg
atgctgggtcgccgtaaaaaaaccggttccaaggtggatccctatgaatggatcacatat
caggaggcttatgatgctgccatccaaattggttccgccatgaagagccgtggtgtcaat
cctggagaccgttgtggcatatatgggtccaactgccccgaatggatcattgcaatggag
gcttgcaatggctatgcagtaacatatgtcccattatacgacaccttgggtccaaatgct
gtggagtttatcataaaccatgctgaagtttcgatagcatttgtacaggataacaagatt
ccttctgttttgtcatgccttgataggtgttcaaatcttaaaactattgtgagttttggt
aatgtttcatcttcacaaaagaaggaagctgaggagcttggtgcatcttgcttcacgtgg
ggagagtttctccagttgggaaatacggattttgacgtaccactgaaaaagaagactaac
atctgcacaatcatgtacactagtggaacaacaggcgaacccaaaggcgttattatcaag
aatgaggctttcatgacccaagtgttgtctattgaccaaatactttatataactgacgta
gtgggaacagaagacgatgtctacttttctttccttcctcttgctcatatatatgaccag
ataatggagacatattgcatctacaagggctcctcaattggattttggcaaggcgatgtc
aggttcttaatggaagatattcaggcgctgaaaccaactttattttgtggcgttcctaga
gtatatgatcgtgtttatgctggtatcagtagccaaatttcatctggaggagcactgcga
agtacattgtttcaatatgcatataactacaaattgggatatctggaaaagggtcttccc
caagacaaagcagcacccttgtttgataggctcgtgtttgataagataagacaagcatta
ggtggacgagttcgtcttctattatcaggagctgctcctttgcctaggcaagtggaggag
tttttgagggtcacttttggagctaatatgtcacaaggatatggtcttactgaaagttgt
ggtgggtgtttcactgcaataagcaatgtgttttctatgatgggaacaattggagtccct
atgacaaccattgaggccaggcttgaatctgtgccagagatgggatatgatgcactctcc
agtgaagcccgtggagaaatttgcctgagaggaaataccttgttctctggttatcacaag
cgtcaagatcttaccgaagaggttctggttgatggttggtttcatacaggtgacattgga
gaatggcagccaaatggatccatgaaaattatcgatagaaaaaagaacatctttaaattg
tctcaaggagaatatgttgccgtagagaatattgaaaacaagtatttgcagtgccccctt
gtaacatcgatttgggtctatggaaacagttttgagccttttttggtggcagtagtggtc
cctgaaagaaatgcccttgaggattgggcaatgaagcataattctaatgttgatttcaaa
tctttatgtggaaatcttaaggcaagaaaatacattttggatgagctcaacagaactggt
cagaaacaccaacttagaggttttgagatgctaaaagcagttcatctggaaccaattccc
tttgacatggagagagatctggtaactccaacattcaagctgaagagatcacaattgctc
aagcactataaggattatattgatcaactgtacaaggaagcgaaggcacagaaggtgtga

KEGG   Cajanus cajan (pigeon pea): 109808144Help
Entry
109808144         CDS       T04868                                 

Definition
(RefSeq) probable acyl-activating enzyme 16, chloroplastic isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109808144
   00071 Fatty acid degradation
    109808144
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109808144
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109808144
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109808144
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109808144
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109808144
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109808144
  Exosomal proteins of breast cancer cells
   109808144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 109808144
NCBI-ProteinID: XP_020226600
LinkDB All DBs
Position
11
AA seq 718 aa AA seqDB search
MSAIPISSAYASTFSYSARALCFFSARNNINRITLHRPVFCQFESKTEEALTRRCSPFLE
SSLLSGSGAVASDEWKAVPDIWRSSAEKYGDKVALVDPYHDPPSIMTYKQLEDAILDFAE
GLRVIGVRPNEKLALFADNSCRWLVADQGMMACGAINVVRGSRSSIEELLQIYNHSESVA
LAVDNPEMFNRIAKVLYLKASIRFIILLWGEKSSLVSKGDKGVPVFTFTEVIHLGQESRR
VLFNSLDNRKHYMYEAIKSDDIATLVYTSGTTGNPKGVMLTHQNLLHQIKNLGDIVPAEV
GDRFLSMLPSWHAYERACEYFIFSCGVEQVYTTVRNLKDDLGLYQPHYLISVPLVYETLY
NGIQKQISTSSFVRKLVALTFIRVSIRYMECKRIYEGKCLTKNQKPPSYLHSILDWLWAR
VMATILFPVHLLAKKLVYSKIHSAIGMSKAGISGGGSLSSHVDKFFEAIGVNVQNGYGLT
ETSPVIAARQLSCNVIGSVGHPIKHTEFKVIDSETDEVLPPGSKGILKVRGPQLMKGYYK
NPSATNHVLDRDGWLNTGDIGWIVPHHSTGRSRNSSGVIVVEGRAKDTIVLSTGENVEPG
ELEEAAMRSSLIHQIVVIGQDKRRLGAVIVPNKEEVLKAARESSIIDSNSSDVSQEKVTS
LIYKELRTWTSESPFQIGPILLVNDPFTIDNGLMTPTMKIRREKVVSQYGDQIENLYK
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaattcctatcagctccgcctatgcttccaccttctcttattccgcgcgcgcg
ctttgcttcttctctgctcgcaacaacatcaacaggatcactcttcaccgacctgtgttt
tgtcaatttgaatccaagacagaggaagcgctgacaagaaggtgctccccctttctagag
agttcattactctctggtagcggtgctgtggcctccgacgagtggaaagctgttcctgat
atttggagatcttctgcggagaagtatggtgataaagtagcattagtagatccgtatcat
gatcctccttcgattatgacatataaacagttggaggatgcaatattggactttgctgaa
gggttgagagttattggagtaagacccaatgagaaacttgcactttttgctgataattca
tgtcgctggcttgtagcagatcaaggtatgatggcatgtggggcaatcaatgtggtaagg
ggttcgaggtcatcaattgaagaattgctgcaaatatacaaccactctgagagtgttgca
ctagctgtggacaatcctgaaatgtttaatcggattgcaaaagtgttgtatttgaaggct
tctataagatttattatactgctatggggagaaaaatcaagcctggtcagtaaaggagac
aagggggtgcctgtctttactttcacagaagtcatacatttgggacaagagagtcgtaga
gtattgtttaattctcttgataataggaagcactatatgtatgaagcaatcaaatctgat
gacattgctactcttgtatacacaagtggaactactggaaatccaaagggtgttatgcta
acccatcagaatcttttgcatcagataaaaaacttgggggatattgtacctgctgaagtt
ggggatagatttctaagcatgctgccttcctggcatgcatatgaaagagcttgtgagtat
ttcattttctcgtgcggtgttgaacaagtatacacaactgtgagaaacttgaaggatgat
ttgggtctttaccaaccacattacttgatttctgttcctttagtctatgaaacgttatac
aatgggattcagaagcagatatctacaagctcctttgttagaaagcttgttgcactcaca
ttcataagggtcagcataaggtacatggagtgtaagcggatttatgagggtaaatgtcta
acaaagaatcagaagccgccttcctatctccattcaatcttggactggttatgggcaaga
gtcatggccacaatattatttcctgttcatttgctggcgaagaaactggtctacagtaaa
attcattcagctattgggatgtcaaaggcaggaataagtggtggtggtagcttatcttct
catgttgataaattttttgaggctattggtgtgaatgtacagaatggatatggtttaaca
gaaacttcaccagttattgctgctcgacagcttagttgtaatgttattgggtctgttggg
catccaattaagcatacagaattcaaagtcattgattctgagactgacgaagttcttcca
cctggttcaaagggtattttgaaagtcaggggcccacaattgatgaagggatactacaag
aatccttcagctacaaaccatgtcttggatagggatggctggctgaatactggggatatt
ggttggattgttcctcaccattcaactgggcggagtcgtaattccagtggagtaattgtt
gtggaaggccgtgctaaagacactattgtgctttctacaggtgaaaatgttgaaccggga
gaacttgaagaagctgccatgaggagtagcctcatacatcaaattgttgttattggccag
gataagcgacgtctaggagctgtaattgttcctaacaaagaagaagtcttaaaggcagca
agggaatcgtcaattatagattccaacagttcagatgtcagtcaggaaaaagtgaccagc
ctaatatataaagaattgaggacatggacgtcagagtctccatttcaaattgggccaatc
cttctcgtaaatgatcccttcacgattgataatgggctaatgacacccacgatgaaaatt
cgaagggaaaaagttgtgtctcaatacggggaccaaatagagaatctgtacaagtaa

KEGG   Cajanus cajan (pigeon pea): 109809370Help
Entry
109809370         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 1-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109809370
   00071 Fatty acid degradation
    109809370
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109809370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109809370
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109809370
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109809370
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109809370
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109809370
  Exosomal proteins of breast cancer cells
   109809370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109809370
NCBI-ProteinID: XP_020228244
LinkDB All DBs
Position
11
AA seq 662 aa AA seqDB search
MKSFSVKVEEGREGKNGTLSVGPVYRNLLAKNGFPPMDPDFSTPWDIFSVSVKNHPNNRM
LGRRPIVDGKIGPYVWKTYKEVYDEVLHMSSALRASGAEPGTKIGIYGANCPQWIVAMEA
CSAQSFVCVPLYDTLGPGAVNFIIDHAEVDFVFVQDKKVKEVLNPDCKSSKRLKAMVCFT
TLTEEQKNGADAIGIKPYSWDDFLHLGKENPKSIFPPRASDMCTIMYTSGTSGDPKGVVL
THENVSALVRGMDLFMEQFEDKMTVDDVYLSFLPLAHILDRTIEEYFFRKGASVGYYHGD
LNALRDDLMELKPTLFAGVPRVFEKVYDGIKKAVDELNPFRRTVFGMLYNYKLGWMKKGY
KHREASRVADLLAFRKVKARLGGRVRLIISGGAALSPEIEEFLRVTTCAFVCQGYGLTET
CGSTTLGYPDEMCMLGTVGAVSVYNEIMLEEVPEMGYNPLESPPCGEICVRGKTVFTGYY
KNPELTKEAIRDGWFHTGDIGEILPNGVIKIIDRKKNLVKLSQGEYIALEHLENVYGITP
IVEDIWVYGNSFKSMLVAVVVPNEEIANKWAYANGHISSFSKLCSLDQLKKYVLSELKLT
AERNKLRGFEHIKGVILDPHPFDMERDLVTATLKKKRNKLLKYFQVEIDEVYQSLSGDKH
KI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccttttcagttaaggttgaagaaggaagggaaggtaaaaatggcaccctttct
gttggccctgtatatcgtaacctccttgccaaaaatggttttcctccgatggatcctgat
ttcagtaccccttgggatattttcagtgtgtctgtcaaaaatcatccgaataaccggatg
ctgggaaggcgtcctattgtcgatggaaagattggaccctacgtgtggaagacatataag
gaagtttatgatgaagttctgcatatgagttctgctttacgagcatctggtgcagaacct
ggaactaaaattggaatttatggagctaattgccctcaatggattgtggcaatggaggct
tgttctgctcaaagctttgtttgtgtgcctctctatgacacccttgggcctggtgccgta
aattttatcatagatcatgcagaagtagattttgttttcgtccaagataagaaggttaaa
gaggttttaaatcctgattgtaaatcctcaaagcgactgaaagccatggtgtgcttcact
acattaacagaggaacagaaaaatggggctgacgcaattggaattaagccatattcgtgg
gatgacttcttgcacttgggaaaagaaaacccaaaaagtatttttccacctcgtgctagt
gacatgtgcacaataatgtatactagtgggacaagtggagaccctaaaggtgttgtttta
actcatgagaacgtatcggctttggtaagaggaatggatcttttcatggaacaatttgaa
gacaagatgactgtggatgatgtgtatttgtcattcctacccttggctcatatcctagac
cgcactattgaggagtactttttccgtaagggtgcatctgttggctactatcatggggat
ttgaacgcgttgagggatgacttaatggaattaaagccgacactgtttgctggtgtccca
cgggtttttgaaaaggtctacgatggtatcaagaaagcagtggacgaactcaatccattt
aggagaacagttttcggcatgctctacaactacaaacttggttggatgaaaaaaggatat
aagcatagagaagcatcacgtgtagccgatctattagccttcagaaaggtcaaagctagg
cttggtggtcgtgttcgacttataatatctggaggggcagctttgagccctgagattgaa
gagttcttgcgtgtcactacatgtgcctttgtgtgccaaggctatggtttgactgaaaca
tgtggatcaactactcttggctatcctgatgagatgtgcatgcttggtactgttggagct
gtatctgtatataatgaaataatgctggaggaggttcctgaaatgggctacaatcctctt
gaaagtcctccatgtggtgaaatatgtgtgagagggaaaactgttttcactggttactac
aaaaatcctgagttaacaaaggaagctattagagatggatggtttcacactggggacata
ggagaaattcttcctaatggtgttattaagataattgacaggaagaagaatcttgttaaa
ctttcccaaggagagtatatagcacttgagcatctagaaaatgtctatggaatcactccc
atagttgaagatatatgggtttatgggaatagcttcaagtcaatgctggttgcagtggta
gttcctaatgaagaaattgccaataagtgggcatatgcaaatggtcacatatcttctttc
tccaaactctgctctcttgaccaactcaagaaatacgtgctatctgagctcaagttgaca
gctgagagaaataagctaaggggctttgaacatataaagggagtgatattagacccgcat
ccatttgacatggaaagagacttggtgacagcaacactgaagaagaaaagaaacaaactg
ctcaagtattttcaggtggaaattgatgaagtataccaaagtttgagtggggataagcat
aaaatttga

KEGG   Cajanus cajan (pigeon pea): 109809571Help
Entry
109809571         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 9, chloroplastic-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109809571
   00071 Fatty acid degradation
    109809571
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109809571
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109809571
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109809571
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109809571
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109809571
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109809571
  Exosomal proteins of breast cancer cells
   109809571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109809571
NCBI-ProteinID: XP_020228499
LinkDB All DBs
Position
11
AA seq 700 aa AA seqDB search
MNAYIAGLVVPLIVLLYRSRNSANRKRRGLPAADAAGEPGFAVRNHRFASPLSSAWQGVA
TLAELFESACREHRERVLLGTRILIQRDTDTAADGRIIEKLELGEYKWLTYGEVFESVSS
FASGLAMLGHRREERVAIYADTRDRWFIALQGCFRRNVTVVTIYASLGEEALCHSLNETE
VTTVICGRKELKSLGKVGGQLDTVKRVICMDDDIPFVFSSDDAQNGWTSTSFADVERLGR
ENPVEADLPLSADVAVIMYTSGSTGLPKGVMMTHGNVLATVSAVMTIVPNLGPKDVYLAY
LPMAHILELVAENLIAAVGGSIGYGSALTLTDTSSKVKEGKTGDATELMPTVMAAVPAIL
DRVRDGVLRKVNAKGGLSKKLFDLAYARRLHAINGSWFGAWGLEKALWNFLVFKKVQAIL
GGRIRFILCGGAPLSGDTQRFINICLGAPIGQGYGLTETCAGGTFSDFDDTSVGRVGPPL
PCSYIKLIDWPEGGYSTNDSPMPRGEIVIGGPNVTLGYFKNEEKTKESYKVDERGMRWFY
TGDIGRFHKDGCLEIIDRKKDIVKLQHGEYVSLGKVEAALLASPFLDNIMVHADPFHNFC
VALVAVSRPALEQWASEQGIAYSNISELCRKEEAMKEVNASLLKEAKAARLEKFEIPAKI
KLVSDPWTPESGLVTAALKLKREIIRKTFQEDLSKLYTSD
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcctacattgctggcctcgtcgttcctctcatcgtcctcctctaccgcagccgc
aattccgccaaccgcaagcgccgcggcttgcccgccgctgacgccgccggcgagcccggt
ttcgcggtgcggaaccaccgcttcgcctcgccgctgagttcggcgtggcagggcgtggcg
acgcttgcggagctcttcgagagcgcatgcagggagcaccgtgagcgcgtcttgctcggc
acgcgcattcttatccagcgtgacactgatacagctgcggacggtagaatcatagagaag
cttgaactcggagaatacaagtggctcacctacggcgaagtctttgaatccgtctccagt
ttcgcctccggtttggccatgctcggtcaccgcagggaagagcgcgtggctatctacgct
gacaccagagaccgttggtttattgcactgcagggttgcttcaggaggaacgtgactgtt
gtgactatatacgcgtcgttgggagaggaagctttgtgtcactcgttgaatgagacagag
gttacaactgtgatttgtgggcgcaaagaattgaaatcactaggaaaagttggtggtcaa
cttgacacagtgaaacgtgtgatatgcatggacgacgatatcccatttgttttctcgtct
gatgatgcccagaatggctggacaagcacttcctttgctgacgttgagaggcttggtaga
gaaaatcctgttgaggctgatttacccctttcagcggatgttgcggttataatgtacaca
agtggaagtacaggattgcccaagggtgtgatgatgacacatggcaatgtcctggcaaca
gtctctgctgtaatgacaatagttcctaaccttgggccaaaggatgtctatctagcatac
ttaccgatggctcatatccttgaattagtagctgagaatttgattgcagctgttggaggt
tctataggatatggatctgctttgactttaactgatacatcaagcaaagtaaaagagggg
aaaacaggggatgccactgaattgatgccaactgtgatggcagctgtaccagcaattctt
gatcgtgtacgtgatggagtgctcaggaaggtaaatgcaaagggaggattgtcaaagaaa
ttgtttgatttagcctatgcacgaaggttgcatgcaattaatggtagctggtttggtgct
tgggggttggaaaaagctctatggaattttcttgtgttcaaaaaggttcaggcaattttg
ggtggtcgcatccggtttatactgtgtggtggtgctcccctctctggtgatactcaaaga
tttatcaatatttgtcttggtgctcctataggtcaaggatatggtctcacagaaacttgt
gctggtgggacattctctgatttcgatgatacatctgttggccgtgttgggccacctctt
ccttgctcatatattaagctaattgactggcctgaaggtggatattcaaccaatgactca
ccaatgccgcgtggtgaaattgtaattggtggtccaaatgtcactcttgggtacttcaaa
aatgaagaaaaaacaaaagaatcttacaaggttgatgaaaggggaatgaggtggttctac
accggtgacatagggagatttcataaagatggttgccttgagatcattgatcggaaaaag
gacatagttaaactgcagcatggagaatatgtgtcattgggaaaggttgaggcagctctt
cttgccagccccttcttagacaacatcatggtgcatgctgatccgtttcataacttctgt
gtggcactcgtggcagtttctcgtcccgcactggagcaatgggcttcagagcaaggcatt
gcttattctaatatttcagaattgtgcaggaaagaagaagctatgaaggaggtgaatgca
tcacttctaaaggaagcaaaggcggctcgtttggaaaaatttgagattcctgcaaaaatt
aagttggtttctgacccatggactcctgaatctggcctagtcactgcagctcttaagctc
aagagagagataattagaaagacttttcaagaagacctctcaaagttatacacctcagac
tag

KEGG   Cajanus cajan (pigeon pea): 109810858Help
Entry
109810858         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109810858
   00071 Fatty acid degradation
    109810858
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109810858
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109810858
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109810858
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109810858
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109810858
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109810858
  Exosomal proteins of breast cancer cells
   109810858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C PSII_BNR
Motif
Other DBs
NCBI-GeneID: 109810858
NCBI-ProteinID: XP_020230027
LinkDB All DBs
Position
Unknown
AA seq 808 aa AA seqDB search
MEWHSEKYRNICVGGARASARAMAQKRFIIEVEKAKEASEGRPSRGPVYRSLIAKDGFPA
PIQGLDSCWDVFRLSVEKYPTSPMLGRREIVDGKAGKYKWLTYKEVYDLVIKIGNSIRSC
GYGEGVKCGIYGANCAEWIMSMEACNAHGLNCVPLYDTLGAGAVEFIICHAEVSIAFVEE
KKIPELLKTFPNATECLRTIVSFGKVTPEQKQEVEKFGLVIYSWDEFLRVGQNQSFDLPL
KKRSDICTIMYTSGTTGDPKGVLISNEGIITLLAGIKRVLESVKEFTFIIIIPICCIWCF
VCLESVPEMGYDALASTPRGEICVKGKTLFSGYYKREDLTKEVMIDGWFHTGDIGEWQPN
GSMKIIDRKKNIFKLAQGEYVAVENLENIYSQVSCVESIWIYGNSFEAFLVAVVNPSKQA
LEHWAQENGISTDFDSLCEDPRAKRYIVEELSKIAKEKKFPTIFCAVPRVLDRVYSGLAQ
KISSGGFLKKTLFNFAYSYKLNNMKKGITHGEASPLLDKIVFDKVKKGLGGRVRLILSGA
APLSAHVEGYLRVVTCAHVLQGYGLTETCAGTFVSLPNEMDMLGTVGPPVPNVDVCLESV
PEMGYDALASTPRGEICVKGKTLFSGYYKREDLTKEVMINGWFHTGDIGEWQPNGSMKII
DRKKNIFKLSQGEYIAVENLENIYSRVSSVESIWIYGNSFESFLVAVVNPSKQALEHWAQ
ENGISMDFDSLCEDPRAKRYIVEDLSKIAKKKKLKGFEFIKGVHLEPVPFDMERDLITPT
YKKKRPQLLKYYQNAIDNLYRSGNKPSD
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggagtggcatagcgagaaatatagaaatatctgtgttggtggtgcaagagcaagtgca
agagcaatggcacagaaaagattcatcattgaggtggagaaagcgaaggaagcgagcgag
ggaaggccatctcgtgggcctgtctatcgtagcctcattgccaaggatggattccctgct
cctatccaaggtctcgattcctgctgggatgttttccggttgtctgttgagaaatatccg
acaagtcctatgcttggtcgacgggaaatcgtcgatgggaaggctggcaagtacaagtgg
ctaacttacaaagaagtatatgatctggtcattaaaattggaaattctatccgcagctgt
ggttatggagaaggtgtaaaatgtggtatttatggtgccaactgtgcagaatggattatg
agcatggaggcctgcaatgctcatggacttaattgtgttcctttatatgataccttgggt
gctggggctgtagagtttattatatgccatgcagaggtctcaatcgcatttgtagaagaa
aagaagatacctgagctattgaagacatttccaaatgcaacagagtgtctcaggacaatt
gtaagctttggaaaggttacccctgaacaaaagcaagaagttgaaaagttcgggttggta
atatattcatgggatgaatttttacgagtgggtcaaaatcagagttttgatcttcctctg
aagaaaaggagtgacatctgtacaataatgtatactagtggaactacgggtgaccccaag
ggagtgttgatatcaaatgagggtattattactctcttagctgggattaagcgagtgttg
gagagtgtcaaagagtttacatttattatcattattccaatttgttgtatttggtgtttt
gtgtgtctggaatctgttcctgaaatggggtacgatgccctagccagcacaccaagagga
gaaatttgtgtaaaaggaaaaaccttgttttcagggtattacaaacgtgaagacctcacc
aaagaggttatgatcgatggatggttccatacaggggatattggagagtggcaacccaat
ggaagcatgaaaattattgatcgaaagaagaatatatttaagcttgcacaaggagaatat
gttgcagttgaaaacctggagaatatttacagtcaagtttcttgtgttgaatctatatgg
atttatggaaacagtttcgaggctttccttgttgctgttgttaaccctagtaagcaagcg
cttgaacattgggcacaagaaaatggtatatccacggacttcgattctctctgtgaagat
cctagagcaaaacgttacatagttgaagagctctcaaagatcgcaaaggaaaagaagttt
ccaactattttctgtgctgttccccgtgtgcttgatagagtgtactcgggtttggcacaa
aagatttcttccggtggcttcttaaagaagacattattcaacttcgcatattcatataag
ctgaataacatgaagaaagggattacacatggagaggcatctccacttcttgataaaatt
gtgtttgataaggtaaagaaaggtttagggggtagagtacgtcttattttgtctggagca
gcacctttatctgcacatgtggaaggttacttacgggttgtgacttgtgctcatgtccta
caaggatatggtctgacggaaacttgcgcgggaacctttgtctctttaccaaatgaaatg
gatatgcttggaacagtgggccctcctgtaccaaatgtggacgtgtgtctggaatctgtt
cctgaaatggggtacgatgccctagccagcacaccaagaggagaaatttgtgtaaaagga
aaaaccttgttttcagggtattacaaacgtgaagacctcaccaaagaggttatgatcaat
ggatggttccatacaggggatattggagagtggcaacccaatggaagcatgaaaattatt
gatcgaaagaagaatatatttaagctttcacaaggagaatatattgcagttgaaaacctg
gagaatatttacagtcgagtttcttctgttgaatctatatggatttatggaaacagtttt
gagtctttccttgttgctgttgttaaccccagtaagcaagcacttgaacattgggcacaa
gaaaatggtatatccatggacttcgattctctctgtgaagatcctagagcaaaacgttac
atagttgaagatctctcaaagattgcaaagaaaaagaagttgaaaggttttgagtttata
aaaggagttcaccttgagccagttccatttgacatggaacgtgaccttatcactccaaca
tataagaagaagaggcctcagttgcttaaatactatcagaatgccattgacaacttgtac
aggagtggaaataaacccagtgactga

KEGG   Cajanus cajan (pigeon pea): 109810934Help
Entry
109810934         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109810934
   00071 Fatty acid degradation
    109810934
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109810934
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109810934
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109810934
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109810934
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109810934
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109810934
  Exosomal proteins of breast cancer cells
   109810934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109810934
NCBI-ProteinID: XP_020230137
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MAQKKFIIEVEKAQEASQGRPSRGPVYRSLFAKDGFPPPIQGLDCCWDVFRLSVEKYPTS
PMLGQREIVDGKAGKYTWLTYKEVYDLVIKIGNSIRSCGYGEGVKCGIYGANCAEWIMSM
EACNAHGLYCVPLYDTLGAGAVEFIICHAEVSIAFVEEKKIPELLKTFPKATECLRTIVS
FGKVTPEQKQEVEKFGLAIYSWDEFLQVGQNQSFDLPLKKRSDICTIMYTSGTTGDPKGV
LISNEGIITLLAGVKRLLESVNEQLTEKDVYISYLPLAHIFDRVIEETFIWHGASIGFWR
GDVKLLIEDIGELKPTIFCAVPRVLDRVYSGLTQKISSGGFLKKTLFNFAYSYKLNNMKK
GITHGEASPLLDKIVFDKIKQGLGGRVRLILSGAAPLSAHVEGYLRVVTCAHVLQGYGLT
ETCAGTFVSLPNEMDMLGTVGPPVPNVDVCLESVPEMGYDALASTPRGEICVKGKTLFSG
YYKREDLTKEVMIDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLENIYSQ
VSCVESIWIYGNSFEAFLVAVVNPSKQALEHWAQENGISTDFDSLCEDPRAKRYIVEELS
KIAKEKKLKGFEFIKGVHLDPVPFDMERDLITPTYKKKRPQMLKYYQNAIDNLYKSGNKP
RA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaagaaattcatcattgaggtggagaaagcgcaggaagcgagccagggaagg
ccatctcgtggacctgtctatcgtagcctcttcgccaaggatggattccctcctcccatc
caaggcctcgattgctgctgggacgttttccggttgtctgttgagaaatatccgacaagt
cctatgcttggtcaacgggaaatcgtcgatgggaaggctggcaagtacacgtggctaaca
tacaaagaggtatatgatctggtgattaaaattggaaattctatccgcagctgtggttat
ggagaaggtgtaaaatgtggtatttatggtgccaattgtgcagaatggattatgagcatg
gaggcctgcaatgctcatggactttattgtgttcctttatatgataccttgggtgctggg
gctgtagagtttattatatgccatgcagaggtctcaatcgcatttgtagaagaaaagaag
atacctgagctattgaagacatttccaaaagcaacagagtgtctcaggacaattgtaagc
tttggaaaggttacccctgaacaaaagcaagaagttgaaaagttcgggttggcaatatat
tcatgggatgaatttttacaagtgggtcaaaatcagagttttgatcttcctctgaagaaa
aggagtgacatctgtacaataatgtatactagtggaactactggtgaccccaagggagtg
ttgatatcaaatgagggtattattactctcttagctggggttaagcgactgttggagagt
gtcaatgaacaattgactgagaaagatgtatacatatcatacctccctcttgcacacatt
tttgatagggtcattgaggagacattcatttggcatggtgcttcgataggtttctggcgt
ggggatgtcaaattgttaattgaagatattggggaacttaaaccaactattttctgtgct
gttccccgtgtgcttgatagagtatactcgggtttgacacaaaagatttcttccggtggc
ttcttaaagaagacattattcaacttcgcatattcatataagctgaataacatgaagaaa
gggattacacatggagaggcatctccacttcttgataaaattgtgtttgataagataaag
caaggtttagggggtagggtacgtcttattttgtctggagcagcacctttatctgcacat
gtggaaggttacttacgggttgtgacttgtgctcatgtcctacaaggatacggtctgacg
gaaacttgcgcgggaacctttgtctctttaccaaatgaaatggatatgcttggaacagtg
ggccctcctgtaccaaatgtggacgtgtgtctggaatctgttcctgaaatggggtacgat
gccctagccagcacaccaagaggagaaatttgtgtaaaaggaaaaaccttgttttcaggg
tattacaaacgtgaagacctcaccaaagaggttatgatcgatggatggttccatacaggg
gatattggagagtggcaacccaatggaagcatgaaaattattgatcgaaagaagaatata
tttaagcttgcacaaggagaatatgttgcagttgaaaacctggagaatatttacagtcaa
gtttcttgtgttgaatctatatggatttatggaaacagtttcgaggctttccttgttgct
gttgttaaccctagtaagcaagcgcttgaacattgggcacaagaaaatggtatatccacg
gacttcgattctctctgtgaagatcctagagcaaaacgttacatagttgaagagctctca
aagatcgcaaaggaaaagaagttgaaaggttttgagtttataaaaggagttcaccttgac
ccagttccatttgacatggaacgtgaccttatcactccaacatataagaagaagaggcct
cagatgcttaaatactatcagaatgccattgacaacttgtacaagagtggaaataaaccc
cgtgcctga

KEGG   Cajanus cajan (pigeon pea): 109811699Help
Entry
109811699         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 8-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109811699
   00071 Fatty acid degradation
    109811699
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109811699
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109811699
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109811699
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109811699
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109811699
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109811699
  Exosomal proteins of breast cancer cells
   109811699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109811699
NCBI-ProteinID: XP_020231094
LinkDB All DBs
Position
Unknown
AA seq 725 aa AA seqDB search
MIGTKGSSSWLKSLNISDIFVWKDHGEYGALAAIVISILVPVLFSALFFGKKKGKIRGVA
VDVGGEAGYAVRNARRTELVEVPWKGAPTMAHLFEQSCNKHTHNRFLGTRKLIQKEVVTS
SDGRKFEKLHLGDYEWETYGEVFARVSKFASGLLKLGHDIDSRVAIFSDTRPEWLIALQG
CFRQNVTVVTIYASLGEDALIHSLNETETSTLICDSRQLKKLDAIKSKLTSIQNIIYFED
DNQEDTFSGSSGSWTISSFSEVEKLGEESPVEPSLPSKNAIAVIMYTSGSTGLPKGVMIT
HGNIVATTAAVMTVIPNLGSKDVYLAYLPLAHVFEMAAESVMLAAGCAIGYGSPLTLTDT
SNKIKKGTKGDATVLKPTLLTAVPAILDRIRDGVVKKVEEKGGLVKNLFHFAYKRRLAAV
KGSWLGAWGLEKLVWDTIVFKQIRTALGGQLRFMLCGGAPLSGDSQHFINICMGAPIGQG
YGLTETFAGAAFSEWDDYSVGRVGPPLPCCYIKLVSWEEGGYLTSDKPMPRGEIVVGGFS
VTPGYFKNQEKTKEVFKVDEKGMNWFYTGDIGQFHPDGCLEIIDRKKDIVKLQHGEYISL
GKVEAALSSCDYVDNIMVYADPFHNYCVALVVASHQSLEKWAQQAGIDYKDFPDLCNKPE
TVTEVLQSISKVAKSAKLEKSEIPAKIRLLPDPWTPESGLVTAALKIKREQLKAKFKDDL
QKLYA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgattggtacaaagggcagttcctcttggttaaaaagtctgaatatcagtgacatattt
gtctggaaagatcatggagaatatggagctctggcggctatagtcataagcatccttgtt
cctgtcttgttttcagctttgttctttggaaagaaaaaaggaaaaataagaggtgtggct
gtagatgttggtggtgaggcaggttatgcagtacgtaatgctagaagaactgagttggtt
gaagttccttggaaaggagccccaaccatggctcatctatttgagcaatcctgtaataaa
catacccacaatcgatttcttggaacaagaaaactaatacaaaaggaggttgttacatct
agtgatggcaggaagtttgagaaacttcatttaggagactatgaatgggaaacctatgga
gaggttttcgctcgcgtgtcaaaatttgcttctggtcttcttaagttaggccatgatata
gatagccgtgttgccattttctccgatacccggcctgaatggctcattgcccttcagggt
tgcttcaggcagaatgtaacagttgttactatttatgcttctttaggtgaggatgccctg
atccactcactaaacgagaccgaaacatctactctgatctgtgactccagacaattgaag
aagttggatgcaataaaatcaaaactaacatctatacaaaatattatttactttgaagat
gataaccaagaagatactttctcaggaagttcaggcagctggacaatttcatcctttagt
gaagttgagaaacttggggaagaaagtcctgttgagccaagcctgccttccaagaatgct
attgcagttatcatgtacacaagtggtagtactggtctgccaaagggtgtcatgattact
catgggaatattgtagccactacagcagctgttatgacagtgattccaaatctaggtagc
aaggatgtgtacttggcatacttgccccttgctcatgtttttgaaatggcagcagagtct
gttatgttggctgcaggttgtgcaattggttatggttctcctctgactttgactgacaca
tctaataaaatcaagaaaggaaccaagggcgatgctacagtgttaaagcccactcttttg
acagccgtaccagctattcttgatcggattcgagatggagttgtaaaaaaggttgaggaa
aaagggggtcttgtgaagaatctttttcattttgcttacaagcgccgactggctgctgta
aaaggaagctggctaggagcctggggattggaaaagttggtgtgggataccattgtcttt
aagcaaatccgtactgcacttggaggccagctccgctttatgctttgtgggggagctcct
ttatctggtgattcacaacacttcatcaatatttgcatgggggctcctattgggcaagga
tacggcttgactgaaacatttgctggagctgccttttcagagtgggatgactacagtgtg
ggacgtgttggtccacctcttccttgttgctacattaagcttgtttcttgggaagaagga
gggtatctgacatcagataaaccaatgccaaggggagagattgtagttggaggatttagt
gtgacacctggttactttaagaatcaagagaaaactaaagaagttttcaaggttgatgag
aaaggtatgaactggttttatactggcgatattgggcaattccatcctgatggatgtctt
gaaattatagataggaagaaagacattgtcaaacttcaacatggagaatatatatctctt
ggaaaggttgaggcagcactatcatcatgtgattatgtggataatataatggtttatgca
gacccctttcacaattactgtgtggctctagttgttgcttcacatcagtcactggagaag
tgggcccaacaagctggtatagattacaaagattttcctgatctttgtaacaaacctgaa
actgtcactgaggttctgcagtcaatttctaaggttgcaaaatctgcaaagctggagaaa
tctgaaattcctgcaaagattaggttgttgccagatccatggactcctgaatctggatta
gttactgctgctctcaagataaagagagagcagctgaaagccaaattcaaagacgatctt
cagaagttgtacgcatga

KEGG   Cajanus cajan (pigeon pea): 109811711Help
Entry
109811711         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 8-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109811711
   00071 Fatty acid degradation
    109811711
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109811711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109811711
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109811711
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109811711
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109811711
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109811711
  Exosomal proteins of breast cancer cells
   109811711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C Pullulanase_Ins
Motif
Other DBs
NCBI-GeneID: 109811711
NCBI-ProteinID: XP_020231106
LinkDB All DBs
Position
Unknown
AA seq 372 aa AA seqDB search
MFLQCFRFGPTVGAKMYLPEGTLIVFRGVGGPNESFRWILRRGEVEDKGGFVKNLFHFAY
QRRLAAVKGSWFGAWGLEKFVWDTIVFRKIRAAIGGHLRYMLCGAAPLSIESQHFINICM
GSVIGQAYGLTKTFAGATFSEWFDNKVGRVGPPLSCCYIKLVSWEEGGYLTSDKPMPRGE
IVIGGFSVTAGYFKNQEKTNEVFKVDKHGMRWFHTGDIGQFHSDGCLEIIDRKKDIVKLQ
HGEYVSLGKVEAILSTCDYVDNIMVYVDPFNHYCVALVVASYYPLVKWAQQVGIKHKDFT
DLCNKPETINEVLQSISKVAKAMKLVKTEIPTKIKLLSDPWTPESGLVTAALKIKMEQLK
AKFKDDLRNLYA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgcaatgctttcggttcggccccacggtgggcgccaagatgtacttgcctgag
ggtacactcatagtcttcaggggtgtaggagggccaaacgagagctttaggtggattctt
cggaggggggaggttgaggataaaggggggtttgtgaagaatcttttccattttgcatac
cagcggcgattggctgctgtgaaaggaagctggtttggagcttggggattggagaagttt
gtttgggatacaattgtctttagaaaaattcgtgctgcaattggaggccacctacgttat
atgctttgtggagcagcccctttatctatagaatcacaacactttatcaatatctgcatg
gggagtgttattgggcaagcatatggcttgactaaaacatttgcaggggctacattttct
gaatggtttgacaacaaggtggggcgtgttggtccacctctttcttgttgctacattaag
cttgtttcttgggaagaaggggggtatttgacatcagacaaaccaatgccacgtggagag
attgtaattggaggatttagtgtgacagcaggttattttaagaatcaagaaaaaactaat
gaagtgttcaaggttgataagcatggtatgcgttggttccatacgggtgatattggacaa
ttccattcggatgggtgtcttgaaatcatagataggaagaaagatattgtcaaacttcaa
catggagaatatgtctctcttggaaaggttgaggcaatactatcaacatgcgattatgtg
gataatataatggtttatgtagacccttttaaccattattgtgttgccctagttgttgct
tcatattatccccttgtgaaatgggcacaacaagttggtattaagcacaaagattttact
gatctgtgtaacaaacctgaaactattaacgaggtcttgcaatctatttctaaggttgca
aaagctatgaagttggtgaaaactgaaattccgacaaagattaagttattatcagatcca
tggacacctgaatctggattagtcactgctgctctaaagataaaaatggaacaattaaaa
gccaaattcaaagatgatcttcgaaatttgtatgcatga

KEGG   Cajanus cajan (pigeon pea): 109814440Help
Entry
109814440         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 6, peroxisomal
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109814440
   00071 Fatty acid degradation
    109814440
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109814440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109814440
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109814440
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109814440
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109814440
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109814440
  Exosomal proteins of breast cancer cells
   109814440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109814440
NCBI-ProteinID: XP_020234462
LinkDB All DBs
Position
2
AA seq 700 aa AA seqDB search
MDHTPAAQRRLRAIHAHLTATATATAGDSNSHLRSSPTSAEFFSEQGYSVVLPPKLQTGK
WNVYRSVRSPLQLVTRFPDNPEVGTLHDNFVRAVDTFRDYKYLGTRIRVDGTVGEYKWMT
YGEAGTARSAIGSGLIYYGVPKGSSIGLYFINRPEWLIVDHACSAYSFISVPLYDTLGPD
AVKYIVNHAVVQVIFCVPQTLNSLLSYLSDIPTVRLIVVVGGMDDQIPSLPSSAGVNIVT
YSKLLNQGRSNLQPFCPPKPDDIATICYTSGTTGTPKGAVLSHGNFIASVAGATVDEKFG
PSDVYISYLPLAHIYERANQVMTVYFGIAVGFYQGDNIKLMDDVAALRPTIFCSVPRLYN
RIYAGIINAVKTSGGLKERLFNAAYNAKKQALLHGKNPSPMWDRLVFNKIKEKLGGRVRF
MGSGASPLSPDVMEFLKICFGGRVTEGYGMTETTCVISCIDDGDTLGGHVGSPNPACEIK
LVDVPEMNYTSDDQPNPRGEICVRGPTIFQGYHKDEVQTREVVDEEGWLHTGDIGMWLPG
GRLKIIDRKKNIFKLAQGEYIAPEKIENVYVKCKFVAQCFVYGDSLNSTLVAVVSVDPDI
LKAWAASEGIMYNDLPQLCDDPKARAAVLAEMDAVGREAQLRGFEFVKAVTLVPEPFTIE
NGLLTPTFKIKRPQAKEYFGRAISNMYSELSRTDSSQKTL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggatcacactcccgctgcgcaacgtcgtctccgagccattcacgctcacctcaccgcc
accgccaccgccaccgccggcgattctaactcccacctccgatccagccccacctctgcc
gagttcttctccgagcaaggttatagtgttgtactcccaccgaaattacaaacaggaaag
tggaacgtctacagatctgtacgatctcctctgcagttggtgaccaggtttcctgataat
cctgaagttggtaccctgcatgataattttgtgcgtgcagttgacacctttcgagactac
aaatatctgggaactcgtatccgggttgatggaactgttggggagtacaaatggatgaca
tatggagaagcaggtactgctaggtcggcaataggttctggtttgatttattatggagtc
ccaaagggctccagcattgggttgtattttattaacagacccgagtggctcattgttgat
catgcttgctctgcatactcattcatatcggtgcctttgtatgatactcttggtcctgat
gccgtcaagtatattgttaatcatgccgttgtacaagttattttttgtgtacctcaaaca
ttaaattcattgctgagctacttatctgatattccaactgtacgtctaattgtggtagtt
ggaggtatggatgatcaaattccatcacttccatcgtcagctggagttaacattgttaca
tattcaaagttacttaatcagggacgcagcaatcttcagcccttttgtccaccaaaacct
gatgatattgcaaccatttgctatacaagtggaacaactggaaccccaaaaggtgctgtc
ttgtcccatggaaactttattgcaagtgttgctggggctactgtagacgagaaattcggt
ccttctgatgtttatatatcttatctccctttggcacacatttatgaacgagcaaaccag
gtcatgacagtatattttggcattgcagtgggattctaccagggggataatattaaatta
atggatgatgtagctgctctaagacctactatcttctgtagtgttcctcggctatataac
agaatatatgctggtatcattaatgctgttaaaacatctggtggtctgaaggagaggctg
tttaatgctgcatacaatgctaaaaaacaggcattattgcatgggaagaacccatctcca
atgtgggacagattagttttcaacaagataaaggaaaagcttggaggacgagttcgtttt
atggggtcaggtgcctcacctttatcacctgatgtcatggaatttttaaagatttgcttt
ggtggtcgagtgactgaaggatatggaatgacggaaactacttgtgttataagctgcatt
gatgatggtgacacacttggtggtcatgttggctctcctaatccagcctgtgagataaaa
cttgtggatgttccagaaatgaactatacatctgatgatcagcccaatccccgtggtgaa
atttgtgtcaggggtcccactatttttcaaggttatcacaaagacgaagttcagacgaga
gaagtcgttgatgaagaaggatggctgcatactggagatattgggatgtggttacctggt
ggtcgtctcaaaattattgataggaagaagaatatctttaagttggcacaaggcgagtac
attgctcctgagaagattgaaaatgtatatgtcaaatgcaagtttgtggcacagtgcttt
gtatatggtgatagcctaaattctactttggttgctgttgtctctgtggatcctgatatc
ttgaaagcatgggctgcttcagaaggcataatgtataatgatttaccacaactttgcgat
gatccaaaagcaagggcagctgtcttggctgagatggatgctgttggacgagaggcacag
cttagaggttttgaattcgtaaaagctgtaactttggtgcctgaaccatttactattgaa
aatggtctgctgactccaacattcaagattaagagaccccaagcgaaggaatatttcgga
agagcaatatctaatatgtacagtgagctctcaagaactgattcttctcagaaaacgttg
tga

KEGG   Cajanus cajan (pigeon pea): 109814741Help
Entry
109814741         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109814741
   00071 Fatty acid degradation
    109814741
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109814741
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109814741
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109814741
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109814741
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109814741
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109814741
  Exosomal proteins of breast cancer cells
   109814741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109814741
NCBI-ProteinID: XP_020234829
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MKSFAAKVEEGREGTNGELSVGPVYRNLLSKNEFPPLDPDLNSAWDIFSMAVKKYPKNRM
LGWREFVDGKIGPYVWKTYEEVYDEVLHIGAALRASGAEPGSRIGIYGANCPQWIVAMEA
CCAHSLICVPLYDTLGPGAVNFVIDNGEVDFVFVQDKKVIHLLNPDCKSSQRLKAMVSFT
SLTEKEKDKAITIGIKPYSWEEFLHMGEENPSNILPPQPCNICTIIYTSGTSGDPKGVVL
AHENITAFVRGMDLFLEQFEEKMTVEDVYLSFLPLAHILDRTIEEYFFHKGASVGYYHGD
LNALAGDLMELKPTFFAGVPRVFEKIHEGIKKSVEELNPVRRTVFGMLYKYKLAWMNKGY
KHSNASPLADLLAFRKVKARLGGRIRLIIAGGAPLSSEVEEFLRVTSCAFVCQGYGLTET
CGSTTLAFLDEMCMLGTVGSVSVYNEIRLEEVPEMGYNPLGSPSCGEICVRGKSVFTSYY
KNPELTRDAIRDGWFHTGDIAELQPNGVVKIIDRKKNLIKLSQGEYIALEHLENVYGITP
IVEDVWVYGNSFRSALVAVVVPNEEITKKWAFSNGYMAPFLELCSLDQFKKHVLSELKMT
ADRNKLKGFEYIKGVILEPQPFDMEIDLVTSTMKKRRNNMLKYYQVEIDEVYRSLSGDKH
KV
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttttgcagctaaggttgaggaaggaagagaaggtactaatggtgagctatct
gtaggtccggtatatcgcaacctcctctccaaaaatgagtttcctccactcgatcctgat
ttaaatagtgcatgggatattttcagcatggctgtcaaaaagtatcctaagaaccgtatg
ttgggatggcgtgaatttgttgatggaaagataggaccatatgtctggaagacgtatgag
gaagtttatgatgaagttctgcatattggtgctgctttacgagcatctggtgctgaacct
ggcagtcgaataggaatttatggagctaactgtcctcaatggatcgtggcaatggaggct
tgttgcgcccacagcttgatttgtgttcctctctatgacacccttgggccaggtgctgta
aactttgttatagataatggagaagtagattttgtgtttgtccaagataagaaggttata
catcttttgaatcctgattgtaaatcttctcaacgactgaaagcgatggtctctttcact
tcattaacagagaaagagaaagacaaggccatcaccattggaattaagccatattcatgg
gaagagttcttgcacatgggggaagaaaatccatcaaacattttaccacctcagccttgt
aatatctgcacaataatatatacaagtggaaccagtggagaccctaagggtgtagtcttg
gcccatgaaaacattacggcattcgtaagaggaatggatcttttcttggaacaatttgaa
gaaaagatgactgtggaagatgtgtatttgtctttcctcccattggctcatattcttgac
cgcacgatcgaggagtactttttccataagggagcatctgtgggttactaccatggggat
ctaaatgcgttggcgggtgatctaatggaattgaaaccaacgttttttgccggggttccc
cgagtttttgaaaaaattcatgaaggtatcaaaaaatcagtggaagaactcaatccagtg
aggagaacagtttttggcatgctttacaaatacaaacttgcctggatgaacaaaggatat
aaacacagtaatgcatcacctttagcagatctgttagctttcagaaaggtcaaagctcgg
ttaggtgggcgtattagactaataatagctggaggtgcacccttgagctcagaggtggaa
gaattcttgcgcgtaacttcttgtgcttttgtatgtcaaggctatggtttgactgaaact
tgtgggtcaactactcttgcctttcttgatgaaatgtgcatgcttggtactgttggttct
gtatctgtatacaatgaaatacggctggaggaggttccagagatggggtacaaccctctt
ggaagtccttcatgtggtgagatatgtgtgagaggcaaatctgtttttactagctactac
aaaaaccccgagttaacaagggatgccataagagatggatggtttcacacaggggatata
gcagaactgcaacctaatggtgttgtaaagattattgacaggaagaaaaatcttataaag
ctttctcaaggagagtatattgctcttgagcatttggaaaatgtttatggaatcactcca
attgttgaagatgtatgggtttatgggaatagcttcaggtcagcgctggttgcagtagtg
gttccaaatgaagaaattaccaagaagtgggcattttcaaatggttacatggctcctttc
ttagaactatgttctctagaccaattcaagaaacatgtgttatctgaactcaagatgact
gctgatagaaacaagctgaagggctttgaatatatcaaaggggtgatattagagccgcaa
ccatttgacatggaaatagacttggtgacttcaacaatgaagaagagaagaaataatatg
ctcaagtattatcaagttgaaatagatgaagtataccgaagtttgagtggagataagcat
aaagtttga

KEGG   Cajanus cajan (pigeon pea): 109816069Help
Entry
109816069         CDS       T04868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 9, chloroplastic-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00061  Fatty acid biosynthesis
ccaj00071  Fatty acid degradation
ccaj01100  Metabolic pathways
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109816069
   00071 Fatty acid degradation
    109816069
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109816069
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109816069
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109816069
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109816069
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109816069
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109816069
  Exosomal proteins of breast cancer cells
   109816069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109816069
NCBI-ProteinID: XP_020236521
LinkDB All DBs
Position
Unknown
AA seq 692 aa AA seqDB search
MNPYIFGAILPLLVTLLVRNASRGPKRRGLPVDVAGDPGLALRNHRFESPVRSAWEGVAT
LAELFEAACKAHAARLLLGTRALVAREVDARSFEKLHLGEYRWLSYAAVFDVVSAFASGL
AYIGHLREERVAIFADTRQEWFMALQGCFRRNVTVVTIYASLGEEALCYSLNETEVTTVI
CGQKELRTLLNISGQLDSVKRVICLDDDIPSNASAIAFDWIITSFAEVERLGRENPVDAD
LPLSADVAVIMYTSGSTGLPKGVMMTHGNVLATLSAVMTIVPDIGTKDVYLAYLPMAHIL
ELAAENLMAAVGVPIGYGSPLTLTDTSNKIKRGTKGDATALRPTLMAAVPAILDRVRDGV
FKKVNAAGGLPKKLFHLAYARRLQAINGSWFGAWGLEKALWNFLVFRKVRAILGGRIRFI
LCGGAPLSGDTQKFINICLGAPIGQGYGLTETCAGGTFSDVDDTSVGRVGPPLPCSYIKL
IDWPEGGYLTNDSPMPRGEIVIGGPNVTLGYFKNEEKTKELYKVDERGMRWFYTGDVGRF
HPDGCLEIIDRKKDIVKLQHGEYVSLGKVEAALIVSPFVDNIMVHADPFHSYCVALVVGS
QSTLEEWASEQGISDVSFSELCEKEETVKEVHASLVKEGKEARLEKFEIPAKIKLLSDPW
TPETGLVTAALKLKREAIKKTFDGELSKLYAS
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaatccctacattttcggagccatactccctctcctcgtcacgctcctcgtccgcaac
gcctcccgggggcccaaacgccgaggccttccggtcgacgtcgccggagaccccggcctc
gccctccgcaaccaccgcttcgagtcgccggtgcggagcgcgtgggagggagtcgccacg
ctcgccgagctcttcgaggcggcctgcaaggcgcacgcggccaggctcctgctcgggacg
cgcgccctggtggctcgcgaggtggacgccaggtccttcgagaagcttcacctgggagag
taccgctggctgtcgtacgccgcagtcttcgacgtcgtttcggccttcgcctctggcttg
gcctacatcggccatctcagggaggagcgcgtcgcgatcttcgccgacacgcgccaggag
tggttcatggcgttacagggttgtttcaggcgaaatgtgacagttgtgactatatatgca
tcattgggagaggaagctttatgttactcattgaatgagacagaggttacaacagtgata
tgtgggcaaaaagaattgagaacacttctaaacattagtggacaactagactcagtgaaa
cgtgtgatatgcttggatgatgatatcccatctaatgcctcagctattgcatttgactgg
ataatcacttcctttgccgaggttgagagacttggtagagaaaatcctgttgatgctgat
ttacctctttcagcagatgttgcagttataatgtatacaagtggaagtacaggattacct
aagggtgtgatgatgacacatggcaatgtcttagctacactctctgctgtgatgacaatt
gttcctgacattgggacaaaggacgtatatcttgcatacttaccaatggctcatatctta
gaattagcagctgaaaatttgatggcagctgttggggttcccatagggtatggttctcct
ttgacccttactgatacatcaaacaagataaaaaggggaacaaaaggggatgccactgca
ctgaggccaactttaatggcagctgtaccagcaattcttgatcgtgttcgagatggagtg
ttcaagaaggtaaatgcagcaggaggattgccaaagaagttgtttcatttagcctatgca
cggaggcttcaagcaatcaatggcagttggtttggagcttggggcttggaaaaggctctt
tggaattttcttgtgttcagaaaggtccgggcaattctgggcggccggatccgttttata
ctgtgcggtggtgctcccctttctggtgatacccagaagttcatcaatatttgtcttggt
gctccaatcggtcaaggatatggtcttacagagacttgtgctggtgggaccttctctgat
gttgatgatacatccgttggccgtgtcggaccacctcttccatgctcatatattaagcta
atcgactggcctgaaggtggatatttaacaaatgactcaccaatgccccgtggtgaaatt
gtaattggtggtccaaatgtcactcttgggtatttcaaaaatgaagaaaaaacaaaagaa
ttatacaaggttgatgaaagaggaatgaggtggttttacactggtgatgttgggagattt
catccggatggatgccttgaaatcattgatcgtaaaaaggacattgttaaactgcagcat
ggagaatatgtctcattgggaaaggttgaggcagctcttattgttagcccctttgtggac
aatattatggtccatgctgatcctttccatagttactgtgtggcacttgtggtgggttct
cagtccacattggaagaatgggcttcagaacaaggaatttctgatgtcagtttttcagaa
ttgtgtgagaaagaagaaactgtgaaggaggtacatgcatcacttgtaaaggaaggaaag
gaagctcgtttggagaaatttgagattcctgcgaaaattaaattgctttctgacccatgg
actcctgagactggtttagtcactgctgctctcaaactcaagagagaggccataaaaaag
acttttgatggagaactttcgaagttgtatgcttcatag

DBGET integrated database retrieval system