KEGG   Cajanus cajan (pigeon pea): 109795414Help
Entry
109795414         CDS       T04868                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00020  Citrate cycle (TCA cycle)
ccaj00640  Propanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109795414
   00640 Propanoate metabolism
    109795414
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109795414
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     109795414
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     109795414
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109795414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 109795414
NCBI-ProteinID: XP_020210506
LinkDB All DBs
Position
2
AA seq 422 aa AA seqDB search
MVRGLLNKLVSRSLSVAGKWQHNQLRRLNIHEYQGAELMNKHGINVPRGVAVSSVEEVRK
AIKDVFPNEKELVVKSQILAGGRGLGTFKSGLQGGVHIVKTEQVEDIAGKMLGQILVTKQ
TGPQGKIVGKVYLCQKLSLVNEMYFAITLDRTSAGPIIIACRKGGTSIEDLAEKFPDMIA
KVPIDVFEGITDEDAAKVVDGLAPKVADRNKSIEQVKNLYKLFVDCDCTLLEINPIAETA
DNQLVAADAKLNFDDNAAYRQKEIFALRDTTQEDPREVIAAKADLNYIGLDGEIGCMVNG
AGLAMATMDIIKLHGGTPANFLDVGGNASEGQVIEAFKILTADDKVKAILVNIFGGIMKC
DVIASGIVNAAKEVALKVPVIVRLEGTNVDQGKRILKESGMALITAEDLDDAAQKAVKAA
YK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggtgagaggattgctcaacaagctcgtctctcgctccctctccgtcgccggaaagtgg
cagcacaaccagctccgccgcctcaacatccatgagtaccagggcgccgaattgatgaac
aaacacggaatcaacgttccgagaggcgtagctgtttcctctgttgaagaggtcagaaag
gccatcaaggatgtcttccctaacgagaaagagttggtggttaagagtcaaattttagcc
ggtggacgaggtttgggcacttttaagagtggtcttcagggaggagtgcacattgttaag
actgaacaggttgaagacatagccgggaagatgcttggacagatactagttaccaaacag
accggtcctcagggaaaaatagttggcaaggtttacttgtgccaaaagttgtcacttgta
aatgagatgtactttgctataacactggatcgtacaagtgctggtccaattattattgct
tgtagaaagggaggaaccagcattgaagaccttgcagagaaatttccagacatgattgct
aaggtacctattgatgtttttgaaggaatcactgatgaagatgctgcgaaggttgttgat
ggtttggctcccaaagtggcagatagaaataagtcgattgaacaagtgaagaatttgtat
aaactttttgttgattgtgactgcacgcttttggaaatcaatcccatagcagagacagct
gataaccaattggtggctgctgatgctaagttgaattttgacgataatgctgcatatcgt
cagaaagagatatttgctcttcgtgatacaacacaagaggaccctcgagaggtgattgct
gcaaaggcagatttaaattatattggattagatggagaaattggctgcatggtgaatgga
gcagggttagcaatggccacaatggatataattaaactgcacgggggtactcctgccaat
tttctggatgtaggtgggaatgcctctgaaggccaggtgattgaggcatttaaaatattg
accgctgatgacaaagtgaaggcaattttggttaacatttttggtggtataatgaagtgt
gatgttattgcaagtggaatagtgaatgctgcaaaagaggttgcactgaaagtaccggta
atagttcgtctggaaggcaccaatgttgatcaaggaaaaagaatactgaaggaaagtggt
atggcattaataacggccgaagatttagatgatgctgctcagaaagctgtgaaagcagct
tacaaatga

KEGG   Cajanus cajan (pigeon pea): 109797466Help
Entry
109797466         CDS       T04868                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00020  Citrate cycle (TCA cycle)
ccaj00640  Propanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109797466
   00640 Propanoate metabolism
    109797466
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     109797466
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     109797466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 109797466
NCBI-ProteinID: XP_020213104
LinkDB All DBs
Position
3
AA seq 323 aa AA seqDB search
MGRQAVTKLLSIAARRHGIRQFSSATPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTN
MVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVV
CITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR
SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLKKFLADPQTEGIILIGEIGGT
AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT
VVESPAKIGAAMLDVFKQKGLVQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggaagacaagccgtgacaaagttgctgtccatcgccgcgcgccgccacggcatccgc
caattctcgtcggcgacgcccgcggtcttcgtcgacaagagcacgcgcgtgatctgccaa
ggcatcaccggcaagaacggcaccttccacaccgagcaagccatcgaatacggcaccaac
atggttggcggtgtcactcccaagaaaggcggaacggagcacctcggccttcccgtcttc
aacaccgtcgccgaagccaaggccgaaaccaaggccaacgcttccgtcatctacgtccct
ccgccgttcgccgccgccgccatcatggaggccatggaggctgagttggatctcgtcgtc
tgcatcaccgaggggattcctcagcacgacatggtgcgggttaaggcagcgctgaacagg
cagtccaagactcgtttgataggaccaaactgccctggtattatcaagcctggggaatgt
aaaattggaatcatgcctggttatattcataagcctgggcgcattggaattgtctctcgt
tctggtaccttgacatatgaagcagtttttcaaacgactgctgttggccttggacaatcc
acttgtgtgggtataggaggagatccctttaatggaacaaactttgttgactgccttaag
aagttcctagcagatcctcaaacagaaggtatcattcttataggagagataggaggaact
gcagaagaggatgctgctgcactaattaaggaaagcggtactgagaagcctgttgttgca
tttattgctggtttaactgctcctcctggtcgtcgtatgggtcatgctggagctattgtg
tcgggtggcaagggaactgcacaagacaaaattaaaaccctcagggaagctggggtcaca
gttgtggagtcccctgccaaaattggagcagccatgctagatgttttcaagcagaagggc
ttggtgcaatag

DBGET integrated database retrieval system