KEGG   Cajanus cajan (pigeon pea): 109796565Help
Entry
109796565         CDS       T04868                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA lyase, mitochondrial-like
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00072  Synthesis and degradation of ketone bodies
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj04146  Peroxisome
Module
ccaj_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109796565
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    109796565
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109796565
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109796565
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     109796565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-GeneID: 109796565
NCBI-ProteinID: XP_020211819
LinkDB All DBs
Position
3
AA seq 407 aa AA seqDB search
MAMHKILQRGRFSNRPPQLIIGSAASHTFPASGAESLHVREISNKEVWNAFDKYDIKGLS
KCLNWISRLNGNNHAASYVVNRHFTSDRNDRYTQEFSSKLLKHIPDYVKIVEVGPRDGLQ
NEKAIIPTDVKVGLIKLLVSSGLLVVEATSFVSPKWVPQLADATDVLAAIQNVEGARFPV
LTPNLKGFEAAVAAGAKEVAVFPAASESFSKANLNSGIEDNLARCRDIASAARSLSIPVR
GYISCVVGCPLEGSIAPAKVAYVAKSLHEMGCSEISLGDTIGVGTPGTVIPMLEAVLGVV
PDDMLAVHFHDTYGQALSNILISLQMGISTVDSSVSGLGGCPYAKGATGNVATEDVVYML
NGLGVKTNVDLGKLMLAGDFICKHLGRVSGSKAATALSKVTTHASKL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatgcataagattttgcaaaggggtcgattctcgaaccgtcctccgcaactgatt
attggttctgctgcttctcacacatttcctgcttctggggctgaatctcttcatgttcgg
gaaatttcaaacaaagaagtttggaatgcatttgacaagtatgatataaaaggtttgtct
aaatgcctgaactggatttcaaggctaaatggcaataatcatgctgcctcctatgttgta
aatcgtcattttacatctgatcgcaatgatagatacacacaggagttctcaagtaagctt
ctcaaacatattccagactatgtaaagatagtggaggttggtccaagggatggattgcaa
aatgagaaggctattattcctactgatgtaaaagttgggttgataaaactgctggtttct
tctgggttgcttgtggttgaggcaactagttttgtctcaccaaaatgggtaccacagttg
gcagatgcaactgatgtattggcagcaattcaaaatgttgaaggtgctaggtttcctgtc
ttgactccaaacctcaaaggttttgaggcagctgttgctgctggagctaaagaagtggct
gtttttcctgcagcttctgaatcattctcaaaagcaaatcttaatagtggcattgaggat
aatcttgctcgttgccgtgatattgcttcagctgctagatccctctcgatcccagtccgc
ggatatatatcatgtgttgtgggatgtcctctggaaggaagtattgctccagcgaaagta
gcatatgtggcaaaatcacttcatgagatgggttgctcagagatttcactgggggataca
attggtgttggcacacctggtactgtcattccgatgctcgaagctgttctgggtgttgtt
ccagatgacatgcttgctgtccactttcatgatacttacggtcaggcgctttcaaatatt
ttaatttcacttcagatggggatcagcacagtggattcatccgtgtctggtcttgggggt
tgtccatatgccaagggtgcaactgggaatgttgccactgaggatgtggtttacatgctg
aatggacttggagtgaaaaccaatgttgaccttggaaagcttatgttggctggggatttc
atctgcaagcatttaggacgtgtatctggttcaaaagcagcaactgccttgagtaaagtt
acaactcatgcctccaaactatga

KEGG   Cajanus cajan (pigeon pea): 109804906Help
Entry
109804906         CDS       T04868                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA lyase, mitochondrial-like
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00072  Synthesis and degradation of ketone bodies
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj04146  Peroxisome
Module
ccaj_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109804906
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    109804906
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109804906
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109804906
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     109804906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-GeneID: 109804906
NCBI-ProteinID: XP_020222413
LinkDB All DBs
Position
9
AA seq 433 aa AA seqDB search
MSSLEEPLGLDKLPSMNTIDRIQRFSSGACRPRGDNLGMGNCWIEGRICSTSNSCNEDNE
EYTTETFPWRRQTRDLSRVDSFSQKTMTMGWNSMKCGMIDNSLYASDYQYSPKCNNKNIQ
DMAYKFMKGIPKFVKIVEVGPRDGLQNEKNIVPTDVKIELIHRLASSGLSVVEATSFVSP
KWVPQLADAKDVMQAVQNLGGIRLPVLTPNLKGFEAAIAAGAREVAVFASASESFSKSNI
NCSIEESLARYRAVTLAAKELSIPVRGYVSCVVGCPVEGSIPPSIVAYVAKELYDMGCFE
ISLGDTIGVGTPGTVVPMLLAVMDVVPVEKLAVHFHDTYGQSLPNILVSLQMGISAVDSS
VSGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMSAGDFISKHLGRPSGSKTA
VAFSRVTADASKI
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtttggaggagccacttggccttgacaagttgccaagcatgaataccatagat
agaatccagaggttctcatctggtgcttgccgtcccagaggagataatttgggtatggga
aactgctggattgaaggacgaatctgcagcacatcgaacagctgcaatgaagacaacgag
gaatatacaacagagacattcccatggagaaggcaaacaagggacctgtcccgagttgac
tctttcagtcaaaagactatgaccatggggtggaactcgatgaaatgtggaatgattgat
aattcactttacgcctcagattaccagtatagtccaaagtgcaataacaaaaatatacag
gatatggcatataagtttatgaaaggtataccaaaatttgtaaagatagtagaagttggt
ccaagggatggactacaaaatgagaaaaacattgtaccaaccgatgtaaagattgaattg
attcatagattggcatcttctgggttatctgttgttgaagctactagttttgtatctccc
aaatgggtcccacagttggcagatgcgaaggatgtaatgcaagcagttcagaacctggga
ggcattagattgccagttctgactcctaatttgaagggttttgaagctgctatagcagcc
ggtgctagagaagtagctgtttttgcatcagcttctgaatcattctcgaaatcaaatatt
aattgtagtattgaagagagtctcgctcgctatcgagctgttactcttgctgctaaagag
ctttcaattcctgttcgagggtatgtatcatgcgttgttggatgcccagtggaagggtca
atccctccgtcaatagtagcatacgtagctaaagaattatatgatatgggttgcttcgaa
atctctcttggggatacaattggagttggtactccaggaactgtagttccaatgcttttg
gctgtaatggatgttgtgccagtggagaagcttgctgtccacttccatgacacttacgga
caatcccttccaaatattcttgtgtccctccaaatggggataagtgcagtggattcttca
gtttctggtctaggtggctgtccatatgctaagggagcttcaggaaatgtagctaccgaa
gatgttgtgtacatgctgaatggacttggtgtcaaaaccaacgttgatcttggaaagctc
atgtcagctggtgacttcatcagcaagcatctggggcgtccatctggctcaaaaactgcg
gttgcctttagccgagtcacagctgatgcttccaagatatga

KEGG   Cajanus cajan (pigeon pea): 109806697Help
Entry
109806697         CDS       T04868                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA lyase, mitochondrial-like
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00072  Synthesis and degradation of ketone bodies
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj04146  Peroxisome
Module
ccaj_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109806697
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    109806697
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109806697
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109806697
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     109806697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-GeneID: 109806697
NCBI-ProteinID: XP_020224763
LinkDB All DBs
Position
2
AA seq 426 aa AA seqDB search
MSSLEEPLGLDKLPSMSTIDRIQRFSSGACRPRVDNLGMGNCWIEGPSCSTSNSCNEDDE
EYTAETFPWKRQTRDLSRDGSFSQKTLTKGRKSMKFGMIDDSFSDCQNSPKCNTIDLQDL
AYKFLNGIPKFVKIVEVGPRDGLQNEKNIVPTSVKIELIHRLASTGLSVIEATSFVSPKW
VPQLADAKDVMQAVHSLRGIRLPVLTPNLKGFEAAIAAGAREVAIFASASESFSKSNINC
SIEESLIRFRAVTRAAKQLSIPVRGYVSCIAGCPVEGPIPPSKVAYVAKELYDMGCFEIS
LGDTIGVGTPGTIVPMLLAVMAVVPIDKLAVHFHDTYGQSLPNILVSLQMGISTVDSSVA
GLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLPKLMLAGHFISNHLGRPSTSKTAIA
FNNSHN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtttggaggagccacttggtcttgacaagttgccaagcatgagtaccattgat
aggattcagcgattctcatctggtgcttgccgtcccagagtagataacttgggcatggga
aactgctggattgaaggaccaagttgcagcacatctaacagctgcaatgaagatgatgaa
gagtatacagcagagactttcccatggaaaagacaaacaagagacttatcccgagatggt
tctttcagtcaaaagactctaaccaaagggagaaagtcaatgaaatttggaatgattgat
gattcattctctgattgccaaaacagtccaaaatgcaatactatagatttgcaagatttg
gcttataagtttctgaatggtataccaaagtttgtaaagatagtagaagttggtccaagg
gatggattacaaaatgagaagaatattgtaccaacatctgtaaagattgaattgattcat
agactagcttctactgggttatctgttattgaggctacaagttttgtttctcccaaatgg
gtcccacagttggctgatgcaaaggatgtaatgcaagcagtgcatagcttgagaggcatc
agattgccagttctgacccctaatttaaagggttttgaggctgcaatagctgctggtgct
agagaagttgctatttttgcatcagcttctgaatcattttcaaaatcaaacattaactgt
agtatcgaagagagccttattcgtttccgagctgttactcgtgctgctaaacaactctca
attcctgttcgagggtatgtatcatgtattgctggatgcccagtggaaggaccaatccct
ccttcaaaagtggcctatgttgctaaagaactatacgatatgggttgctttgaaatctcc
cttggtgacacaattggagttggcacgccaggaactatagttcctatgcttttggctgtg
atggctgttgttccaatagataagcttgctgttcacttccatgacacttacgggcaatcc
cttccaaatatactggtgtccctccaaatggggattagcacagtggattcctctgttgcg
ggtcttggtgggtgcccatatgcgaagggagcttcaggaaatgttgccactgaagatgtt
gtgtacatgttgaacggcctaggtgtcaaaaccaatgttgatcttccaaaactcatgttg
gctggtcacttcatcagcaaccatttggggaggccatccacttcaaaaactgccattgcc
ttcaataatagtcacaactga

DBGET integrated database retrieval system