KEGG   Cajanus cajan (pigeon pea): 109798736Help
Entry
109798736         CDS       T04868                                 

Definition
(RefSeq) hexokinase-3-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00051  Fructose and mannose metabolism
ccaj00052  Galactose metabolism
ccaj00500  Starch and sucrose metabolism
ccaj00520  Amino sugar and nucleotide sugar metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
Module
ccaj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccaj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109798736
   00051 Fructose and mannose metabolism
    109798736
   00052 Galactose metabolism
    109798736
   00500 Starch and sucrose metabolism
    109798736
   00520 Amino sugar and nucleotide sugar metabolism
    109798736
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109798736
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109798736
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109798736
Membrane trafficking [BR:ccaj04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109798736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 109798736
NCBI-ProteinID: XP_020214704
LinkDB All DBs
Position
4
AA seq 508 aa AA seqDB search
MGRAAAGVAVGVAAVACAVAAVAVGRRIRSRGKWKRVARVLREVEEGCEGSVGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTYVHTLPNGTEKGTYYALHLGSTDFRALRVHLHGQQSS
VLEHEVEQQPIPQHLMTSTSKDLFDFIASSLKEFIEKEGNGSELSPDRRRELGFTFSFPV
KQMSVSSGILIKWTKGFSIVDMEGIDVPACLQEALARKELDMRVAALVNDTVGTLALGHY
HDSDTVASVIIGTGTNACYLERVDGIIKCQGLLTTSGYMVVNMEWGNFWSSHLPRTSYDI
DLDSESPNPNDQGFEKMISGMYLGDIVRRVILRMLLESDILGPISSKLSMPFILRTPMMA
AMHEDDSPDLREVARILKDILEIPQVPLKLRKVVVKVCDVVTRRAARLAAAGIVGILKKI
GRDGSGGITGGGRRSDVKMKRTVVAVEGGLYSGYTLFREYLHEALNEILGEDIAKHVILK
VTEDGSGIGAALLAASHSSYNVDTAKML
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggggagagcggcggcgggagtggcggtgggagtggcggcggtggcgtgcgcggtggcg
gcggtggcagtggggcggagaataaggagcagggggaagtggaagagagtggcgagagtg
ttgagggaagttgaggaagggtgcgagggttcggttgggaggctgaggcaggtggtggat
gctatggctgttgagatgcacgcagggttggcttctgaaggtggttctaagctcaaaatg
cttctcacatatgttcatactctccctaatgggactgagaaaggaacatattatgcactt
catcttgggagtacagattttagggctttgcgggttcatttacatggtcaacaatcttct
gtcttggaacatgaagtagagcaacagcctattccccaacatctcatgaccagcacaagc
aaggatctctttgatttcattgcttcttcattaaaggaattcattgagaaagaaggcaat
ggttctgagctttcaccggacagaagaagggaactgggattcacattttctttccctgtg
aaacaaatgtctgtttcctcgggcattttaataaaatggacgaaagggttttcaattgta
gatatggaaggaatagatgttcctgcatgtttgcaggaagcattggcacgaaaagaacta
gacatgagggtggctgccctggtcaatgacactgttggaacattagctctcggccactat
catgactcagatactgttgcttctgtaataattggcactggtaccaatgcttgctatttg
gaaagggttgatggtatcatcaagtgtcaaggtcttcttacaacctcaggatacatggtt
gtaaatatggaatggggaaacttttggtcgtctcatttgccaagaacatcctatgatatt
gatttagattccgaaagccctaatccaaatgatcagggttttgagaaaatgatatcagga
atgtatcttggtgacattgtgaggagagtcattctcaggatgttgctagagtcagatatt
cttggacctatttcttccaagctttcaatgcctttcatactgaggactcctatgatggca
gccatgcacgaggatgattctcctgacttgagagaagtagcaaggatccttaaagacatc
cttgagattcctcaagttcctttgaagttaagaaaagttgtggtgaaggtgtgtgacgtg
gtgactcgcagagctgcgcgattggcagctgctggtattgttggcatcttgaagaagatt
ggtagggatggaagtggtggcattacaggtggtggacgtcgaagtgatgtgaaaatgaaa
agaacagttgtggcagttgaaggaggtttatattctggctacacattgtttagagagtac
ttgcatgaagctttgaatgaaatattgggggaagatattgctaagcatgtgatacttaag
gtcactgaagatggatcgggcattggagcagcactgcttgctgcctcgcattcatcttat
aatgtggatacagcaaagatgctataa

DBGET integrated database retrieval system