KEGG   Cajanus cajan (pigeon pea): 109798794Help
Entry
109798794         CDS       T04868                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109798794
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109798794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 109798794
NCBI-ProteinID: XP_020214781
LinkDB All DBs
Position
4
AA seq 204 aa AA seqDB search
MQLPMAANAVVSPSPFRPNSLLRSSFTGVSVKFSPQSLTISRSKPLTVLAAAKKAVAVLK
GNSAVEGVATLIQEDDGPTKVTVRITGLTPGLHGFHLHEYGDTTNGCISTGAHFNPNNLT
HGAPEDEVRHAGDLGNIIANADGVAETTIVDNQIPLSGPNSVVGRALVVHELEDDLGKGG
HELSLTTGNAGGRLACGVVGLTPA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaccaatggcggccaacgccgtcgtttcaccctcgccgttccgtcctaactcg
cttctccgctcctccttcaccggcgtctccgttaagttctctccccaatccctaaccatc
tcgcgctccaagccgctcaccgtcctcgccgccgccaagaaggccgtcgccgtcctcaag
ggtaactccgccgtcgaaggcgtcgccactctcatccaggaagacgatggcccaacaaaa
gttactgttcgcattactggccttaccccagggcttcatggttttcacctacatgagtac
ggtgataccacaaatgggtgtatctcaacgggagcacattttaatcctaataacttgaca
catggtgctcctgaggatgaagtccgtcatgcgggtgacctgggaaacataattgctaat
gcagatggggttgcagagactacaattgtggataatcagataccactctctggccccaat
tcagtagttggaagagccttggtggttcatgagcttgaggatgaccttggaaagggtggg
catgaacttagtttgacaactggaaatgctggtggaagattagcatgcggtgtggttggt
ttgactccagcataa

DBGET integrated database retrieval system