KEGG   Cajanus cajan (pigeon pea): 109800067Help
Entry
109800067         CDS       T04868                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00592  alpha-Linolenic acid metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01212  Fatty acid metabolism
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109800067
   00592 alpha-Linolenic acid metabolism
    109800067
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     109800067
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     109800067
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     109800067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 109800067
NCBI-ProteinID: XP_020216339
LinkDB All DBs
Position
6
AA seq 724 aa AA seqDB search
MALAKVDFEVGSDGVAVITMCNPPVNALAIPIIKGLKDRFDEAARRNDVKAIVLTGKGGR
FSGGFDISVMKKVHQTGDVSLVPDVSVELVVNSIEDSKKPVVAAVEGLALGGGLELAMGC
HARIAVPRTQLGLPELSLGIIPGFGGTQRLPRLLGLSKAVEMMLTSKPITSDEGRKLGLI
DAIVSSEELLKVSRLWALEIGERRKPWIRSLHKTDKIGSLSEAREVLSTARQQVKKTAPH
LPQQQACIDVIEHGIVHGGYSGVLKEAEVFKQLVMSDTSKGLINVFFAQRAISKVPGVTD
IGLKPTNVKKAAVIGGGLMGSGIATALILGNIRVVLKEINSEFLLKGIKTIETNVSGLVR
RGKLTKQKADAALSLLKGVLDYTEFKDVDLVIEAVIENVSLKQTIFSDLEKICPPHCILA
SNTSTIDLNVVGKKTSSQDRIVGAHFFSPAHIMPLLEIIRTEKTSAQVILDLINVGKIIK
KAPVVVGNCTGFAVNRTFFPYSQGAHLLVNLGVDVYRIDRLISNFGLPMGPFQLQDLAGY
GVAVAVAKEFSGSFSDRIFKSPLLDLLIKTGRNGKNNGKGYYIYEKGSKPKPDPSILPIV
EESRRLCNIMPNGKPISVTDQEIVEMVLFPVVNEACRVLDEGIVIRASDLDVASVLGMSF
PNYRGGIVCWADLVGANHVYTSLKKWAQLYGNFYKPSRYLEERAIKGIPLSAPASSTPKS
KSRL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcgttggctaaggttgattttgaggttggaagtgatggggttgctgtcatcactatg
tgcaacccacccgtgaatgctttggctattccaattatcaaggggttgaaagacagattt
gacgaggcagctaggaggaacgatgtgaaagctatagttttgactggcaaaggtgggaga
ttttctggtggctttgatatcagtgttatgaagaaggttcaccaaactggggatgtctcg
cttgtgcctgatgtgtcggtggaactagttgtcaattcaatagaagattcgaagaagcca
gttgttgcggctgtggaggggcttgctcttggcggtggcttagaactggccatgggatgc
catgcacgtattgcggttccgagaactcaactgggtctgccagagctgtctcttggtatt
attcccggatttggaggaacacaacgtcttccaaggcttcttgggctgtctaaagctgtt
gaaatgatgctgacatctaaaccgatcacatcagatgaagggaggaaattaggacttatt
gatgcaattgtgtcttctgaggagttactaaaggtatctaggttgtgggcacttgaaatt
ggagagaggcgcaaaccttggattcgttcgcttcacaagacagacaaaattggttccctg
tctgaagcgcgtgaggtgttgagtactgccaggcaacaagtcaagaagactgctccacat
ttgcctcagcagcaggcttgcatagatgtgattgaacatggaattgtccatgggggctat
agtggtgttctaaaggaggcagaagtattcaagcaattagtcatgtctgacacctcaaaa
ggtttaattaatgtcttctttgctcagcgggcaatatcaaaggtgccaggtgtaactgat
attggccttaagccaacaaatgtgaaaaaagctgcagtcattggaggaggtttgatgggt
tctggcattgctacagctcttatactaggcaacattcgtgttgtactcaaggaaataaat
tctgaatttcttcttaagggaattaagacaatagaaacaaatgttagtggcttagtaaga
agaggaaagttgacaaaacagaaggcagatgctgcactgtcactgcttaaaggcgttctg
gattacacagagtttaaagatgtggacttggtcattgaggctgtaattgaaaatgtcagt
ctcaaacaaactatatttagtgatcttgagaagatctgtcctccacactgtattttagca
tcaaacacatcaactattgaccttaatgttgttggtaaaaagaccagctctcaagatcgt
attgtgggtgctcattttttcagtcctgcccacattatgcctcttttggagattatacga
actgagaaaacttctgcacaagtgattcttgatctgataaacgttggtaaaatcataaag
aaggctcctgttgtggtgggtaactgcactggctttgcagtgaacagaacattcttccca
tattcacaaggtgcccatttattggtcaacttgggcgtggatgtttacagaatcgacaga
ttgataagcaatttcggccttcccatgggtcctttccagcttcaagacttggctggctat
ggagttgccgttgctgttgcaaaagaattttctggttcattttctgatcgcatatttaaa
tctccactgcttgatcttctaatcaaaactgggcgaaatggtaaaaacaatgggaaaggg
tactacatttatgaaaagggtagcaagccaaaacctgatccttcaatactgccaatagtc
gaggagtctagaagactttgcaatattatgcccaatggaaagcctatatctgttactgac
caagagatcgtggaaatggtactgttcccagtagtgaatgaggcgtgccgtgtcttagac
gaaggaattgttattcgagcatcagaccttgacgttgcatctgttcttggaatgagcttc
ccgaattaccggggtggcattgtttgctgggcagatttggttggggctaatcatgtatat
accagcctaaaaaaatgggcacaattatatggtaacttctataagccctcaaggtatttg
gaagaaagagcgatcaaaggcattcctttgagtgcacctgcttcatctactccaaagtca
aagtctcgtctatga

KEGG   Cajanus cajan (pigeon pea): 109807955Help
Entry
109807955         CDS       T04868                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein MFP2-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00592  alpha-Linolenic acid metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01212  Fatty acid metabolism
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109807955
   00592 alpha-Linolenic acid metabolism
    109807955
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     109807955
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     109807955
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     109807955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 RNA_pol_Rpb1_4
Motif
Other DBs
NCBI-GeneID: 109807955
NCBI-ProteinID: XP_020226302
LinkDB All DBs
Position
11
AA seq 719 aa AA seqDB search
MGHTLIEVGRDGVAIITIVNPPVNSLSFDVLRSLKESFDQALRRNDVKAIVVTGAKGKFS
GGFDISAFGGLQEAKERPKPGYISVEIISDTIEAARKPSVAAIDGLALGGGLEVAMACSA
RLSTPTALLGLPELQLGIIPGFGGTQRLPRLVGLTKALEMMLTSRPVKGKDAFNLGLVDG
LVSPDDLVNTARQWALDILGHRRPWIASLHKTDKLEPLGEAREILKFARAQARKRAPNLH
HPLVCIDVIEAGVLAGPRAGLWKEAEAFEVLVKSDTCKSLVHIFFAQRGTSKVPGVTDRG
LVPRHVKKVAILGGGLMGSGIATALILSNYPVILKEVNQKFLDAGINRIKANLQSRVKKG
KLTQQNFEKAISLLKGTLEYKSFKDVDMVIEAVIENVSLKQQIFADLEKYCPPHCILASN
TSTIDLDLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTKQTSPQVIVDVLDISKKIKKT
PVVVGNCTGFAVNRMFFPYAQAGLLLVERGADVYQIDKVITKFGMPMGPFRLADLVGFGV
AIATGMQFIQNFPERTYKSMLIPLLQEDKRAGETTRKGFYLYDDKRKAIPDPELKNYIEK
ARSITGVSVDPQLVKLQERDIIEMIFFPVVNEACRVLDEGIAVKAADLDISAVMGMGFPP
YRGGIIFWADSLGSKYIYSRLESWSQLYGEFFKPCAYLASRAAKGIPLSASVEQAKARL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgggacacacgctcatcgaggttggacgcgacggcgttgccatcatcaccatcgtcaat
cctcccgtcaattccctctccttcgatgtattgcgcagtttaaaggagagttttgatcag
gctctacggagaaatgatgtcaaggcaattgttgttacaggtgcaaagggaaaattttct
ggaggttttgatatttctgcatttggtggtcttcaagaggcgaaagagcgtccaaagcct
ggttatatatcagtagaaatcatcagtgatactattgaagctgctaggaaaccatcagtt
gctgccattgatggccttgccttgggtgggggcttagaagttgcaatggcatgcagtgct
cggttatcaaccccaactgctctactaggcttgcctgaacttcagcttggaataattcct
ggatttggaggaacacagcgacttcctcgtcttgttggtttgacaaaggcacttgagatg
atgctgacttcaagaccagttaaagggaaggatgcttttaatttggggcttgtagatggt
ttggtgtcacctgatgacttggtgaacactgcacgccagtgggccctggatatcttgggc
caccgacgaccatggattgctagtcttcataagactgacaaattggaaccccttggggaa
gcaagagagattttgaaatttgcacgagctcaggctcgaaaacgggctcctaacctccat
catcctttggtttgcattgatgttattgaagcaggagtacttgctggaccccgagcaggg
ctctggaaggaagctgaagcatttgaagtgcttgtaaagtcagatacttgcaaaagctta
gttcacatattttttgctcaaagaggaacatctaaggtacctggcgttactgatcgtggt
ctggttccaagacacgtcaagaaggttgctatccttggtggaggactaatgggctctggc
atagcaacagctttaatccttagcaactatcctgtcatcttgaaagaagtaaatcagaag
ttcttggatgctggtatcaataggattaaagcaaacttacagagccgtgttaagaaaggt
aaattgactcagcaaaattttgaaaaagccatctctcttctcaaaggtactcttgaatat
aagagcttcaaagatgtggacatggttatagaggctgttattgagaatgtttccttaaag
caacagatatttgctgatcttgaaaagtattgtccacctcattgtatacttgcaagtaac
acttccacaattgacttggaccttattggagagaggaccaagtctcaagatcgaattgtg
ggagcccatttcttcagtcctgcacacgttatgccacttctggaaattgtacgtactaag
cagacctctccccaagtgatagttgacgtgttagatatttcaaagaagataaagaaaact
ccagtggtggttggaaactgcacaggatttgctgttaatcggatgttctttccatatgcg
caagcaggtctcttgcttgttgaacgtggtgccgatgtttatcaaattgataaagtaata
accaaatttggaatgcccatggggccattcagattggctgacctcgttgggtttggtgtg
gcgattgctactggcatgcaatttattcagaattttcctgagcgaacttataaatcaatg
cttattccactcctgcaagaagataagagagctggcgaaacaactcgcaaaggattttac
ttgtatgatgataaacgcaaggctattcctgatcctgaattgaaaaactacatcgagaag
gctcggagcattactggtgtctcagttgatcctcagcttgtcaaattacaagaaagggat
atcatagagatgatattctttcctgtggtgaatgaggcttgtcgggtccttgatgaaggt
attgcagtcaaagcagcagatctcgatatttctgcagtcatgggcatgggttttccacct
tacaggggaggtatcatattctgggctgactctcttggatccaagtacatatattcaaga
ttggagagctggtcacagttgtatggagaattcttcaagccttgtgcctacttggcttca
agagctgccaaaggaattcctctgagtgcctcggtggagcaggcaaaggcgcggttgtaa

KEGG   Cajanus cajan (pigeon pea): 109808378Help
Entry
109808378         CDS       T04868                                 

Definition
(RefSeq) probable enoyl-CoA hydratase 1, peroxisomal
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00310  Lysine degradation
ccaj00360  Phenylalanine metabolism
ccaj00380  Tryptophan metabolism
ccaj00410  beta-Alanine metabolism
ccaj00640  Propanoate metabolism
ccaj00650  Butanoate metabolism
ccaj00903  Limonene and pinene degradation
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01212  Fatty acid metabolism
Module
ccaj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109808378
   00650 Butanoate metabolism
    109808378
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109808378
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109808378
   00310 Lysine degradation
    109808378
   00360 Phenylalanine metabolism
    109808378
   00380 Tryptophan metabolism
    109808378
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109808378
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    109808378
Enzymes [BR:ccaj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     109808378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 109808378
NCBI-ProteinID: XP_020226955
LinkDB All DBs
Position
11
AA seq 264 aa AA seqDB search
MDRQSPENLILVSRDPNGVALVTINRPASLNSLTRPMMVDLAQAFKRLDRDESVRAIILT
GSGRSFCSGVDLTAAEDVFKGDVKDPESDPVVQMERCRKPIIGAIKGFAVTAGFEIALAC
DILVASKGSKFMDTHARFGIFPSWGLSQKLSRIIGVNKAREVSLTATPLTAEVAEKLGFV
NHVVDDSEVLKKSREIAEAIVKNNQDLVLRYKEVINDGIKLDLGTALSLEKERAHDYYNG
MTKEQFRKMQEFIAGRGSKKQSKL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggatcgccaatcgccggagaatctcatactcgtgagccgcgacccaaacggcgtcgct
ctggtcaccattaatcggcccgcttctctcaactcgctcacccggcccatgatggtggac
ctggcccaggccttcaagagactggaccgggacgaatcggtgcgggccatcatactaacc
gggtcgggccgctcgttctgttcgggcgtggatctcaccgccgcagaggacgtcttcaag
ggcgacgtgaaggacccggagagcgacccggtcgtgcaaatggagcgttgccgcaaaccg
ataatcggagccattaaaggattcgccgtcactgcgggattcgaaatcgccctcgcctgc
gatattttagttgcttccaagggatctaagttcatggatactcatgccaggtttgggata
tttccttcgtggggcttgtctcagaagctttcgcgcatcataggggtgaataaagcccgt
gaggtgtctctcacggccacgcctttgactgcggaggtagcagaaaaattgggtttcgtg
aaccatgtggttgacgacagtgaagtgttgaagaaaagcagggaaatcgctgaggccatt
gtgaagaataaccaagacttggtgttgaggtacaaggaggttatcaatgatggcatcaag
ctggatcttggcactgcactttcccttgaaaaggaaagggctcatgattattataatgga
atgacaaaggaacaattcaggaagatgcaggaattcatagctggtcgaggttccaagaaa
cagtccaaactgtag

KEGG   Cajanus cajan (pigeon pea): 109809413Help
Entry
109809413         CDS       T04868                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein MFP2-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00592  alpha-Linolenic acid metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01212  Fatty acid metabolism
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109809413
   00592 alpha-Linolenic acid metabolism
    109809413
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     109809413
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     109809413
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     109809413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 109809413
NCBI-ProteinID: XP_020228309
LinkDB All DBs
Position
11
AA seq 716 aa AA seqDB search
MGHTVMEVGPHGVAIITIVNPPVNSLSYDVFHSLKENFDQAIQRDDVKAIVFTGAKGRFS
GGFDISAFGGGKERPKAGWLSVEIITDTIEAARKPLVAAIDGLALGGGLELAMACNARLS
TPTAQLGLPELQLGIIPGLGGTQRLPRLVGLTKALEMILTSKPVKGKEAFSLGLVDGLVS
PDDLVNAACQWALDILGHRRPWIASLYKTDKLEPLGEAGEILKFARAQAQKRAPNLQHPL
VCIDVIEVGVVSGPRAGLWKEAEASQGLGASDTCKSLVHIFFAQRGTSKIPGVTDCGLVP
RQVKNIAILGGGLMGSGIATALILSSYAVILKEVNEKFLDAGINRIKANLLSRVKKGKLT
QDKFEKAISLLKGTLDYESFRDVDMVIEAVIENVSLKQHIFADLEKYCPPHCILASNTST
INLNLIGKRTKSQDRIVGAHFFSPAHVMPLLEIVRTKQTSPQVIVDVLDISKKIKKIPVV
VGNCTGFAVNRMFFPYTQAGLLLVERGADVYQIDKVITKFGMPMGPFRLADLVGFGVAIA
TGMEFIQNFPERTYKSMLIPLLQEDKRAGETTRKGFYLYDDKRKASPDPELKNYIEKARS
ITGVSLDPKLVKLQEKDILEMIFFPVVNEACRILDEGIAVKAADLDICAVMGMGFPPYRG
GIIFWADTLGSKYIYSRLERWSELYGEFFKPCAYLAARAAKGIPLSAYVEQAKSRL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgggacacacggtgatggaggttggacctcacggcgttgccatcatcaccatcgtcaac
cctcccgtcaattctctctcctacgatgtattccacagtttaaaggagaattttgatcag
gctatacagagagatgatgtcaaggcaattgtttttacaggtgcgaagggaagattttct
ggaggttttgatatttctgcatttggtggtgggaaagagcgtccaaaagctggttggtta
tcagtagaaatcatcactgatactatagaagcggctaggaaaccattggttgctgccatt
gatggccttgccttgggtgggggcttggaacttgcaatggcgtgcaatgctcggttatca
accccaactgctcagctaggtttgcctgaacttcagcttggaataattcctggattagga
ggaacacagcgacttcctcgtcttgttggtttgacaaaggcacttgagatgatactgact
tcaaaaccagttaaagggaaggaagcttttagtttgggacttgtggatggtttggtgtca
cctgatgatttggtgaacgctgcatgccagtgggccctggatatcttgggccaccgacga
ccatggattgctagtctttataagactgacaaattagaaccccttggagaagcaggagag
attttaaaatttgcacgagctcaggctcaaaaacgagctcctaacctccaacatcctttg
gtttgcatcgatgttattgaagtaggagtagtttctggtccccgtgcaggactctggaag
gaagctgaagcatctcaaggacttggagcgtcagatacttgcaaaagcttagttcatata
ttttttgctcaaagaggaacatccaagatacctggggttacggattgtggtctggttcca
agacaagtcaagaacattgccatccttggtggaggactaatgggctctggaatagccact
gctttaattcttagtagctatgctgtcatattgaaagaagtaaacgagaagttcttagat
gctggtatcaataggattaaagcaaacttactgagccgtgttaagaaaggcaaattaacc
caggataagtttgaaaaggccatctctcttctcaaaggtacccttgactatgaaagcttc
agagatgtggacatggtgatagaggctgttattgagaatgtttccttaaagcaacatatc
tttgctgatcttgaaaagtattgtccacctcattgtattcttgcgagtaacacttccaca
attaacttgaacctgattggaaagaggaccaagtctcaagatcgaattgttggagcccat
tttttcagtcctgcacatgttatgccacttctggaaatagtacgtaccaagcagacctct
cctcaagtgatagttgacgtgttagatatttcaaagaagataaagaaaattccagtggtg
gttggaaactgcacaggatttgctgttaatcggatgttctttccatatacgcaagcaggt
ctcttgcttgttgaacgtggtgcagatgtttatcaaattgataaagtaataaccaaattt
ggaatgcccatggggccattcagattggctgacctcgttgggtttggcgtggcgattgct
actggtatggaatttattcagaattttcctgagcgaacttataaatcaatgcttattccc
cttctgcaagaagataagagagctggcgaaacaactcgcaaagggttttatttgtatgat
gataaacgcaaggctagtcctgatcctgaattgaaaaactatattgagaaggctaggagc
atcactggtgtctcccttgatcctaagcttgtcaaattacaagaaaaggatatcttagag
atgatattctttcctgtggtgaatgaggcttgtcggatccttgatgaaggtattgcagtc
aaagcagcagatctcgatatttgtgcagtcatgggcatgggttttccaccttacagggga
ggtatcatattctgggctgacactcttggatccaagtacatatattcaagattggagaga
tggtcagagttgtatggagaattcttcaagccttgtgcctacttggctgcaagagctgca
aaaggaattcctctgagtgcctatgtggagcaggcaaagtcacggttgtaa

DBGET integrated database retrieval system