KEGG   Cajanus cajan (pigeon pea): 109800067Help
Entry
109800067         CDS       T04868                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00592  alpha-Linolenic acid metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01212  Fatty acid metabolism
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109800067
   00592 alpha-Linolenic acid metabolism
    109800067
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     109800067
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     109800067
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     109800067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 109800067
NCBI-ProteinID: XP_020216339
LinkDB All DBs
Position
6
AA seq 724 aa AA seqDB search
MALAKVDFEVGSDGVAVITMCNPPVNALAIPIIKGLKDRFDEAARRNDVKAIVLTGKGGR
FSGGFDISVMKKVHQTGDVSLVPDVSVELVVNSIEDSKKPVVAAVEGLALGGGLELAMGC
HARIAVPRTQLGLPELSLGIIPGFGGTQRLPRLLGLSKAVEMMLTSKPITSDEGRKLGLI
DAIVSSEELLKVSRLWALEIGERRKPWIRSLHKTDKIGSLSEAREVLSTARQQVKKTAPH
LPQQQACIDVIEHGIVHGGYSGVLKEAEVFKQLVMSDTSKGLINVFFAQRAISKVPGVTD
IGLKPTNVKKAAVIGGGLMGSGIATALILGNIRVVLKEINSEFLLKGIKTIETNVSGLVR
RGKLTKQKADAALSLLKGVLDYTEFKDVDLVIEAVIENVSLKQTIFSDLEKICPPHCILA
SNTSTIDLNVVGKKTSSQDRIVGAHFFSPAHIMPLLEIIRTEKTSAQVILDLINVGKIIK
KAPVVVGNCTGFAVNRTFFPYSQGAHLLVNLGVDVYRIDRLISNFGLPMGPFQLQDLAGY
GVAVAVAKEFSGSFSDRIFKSPLLDLLIKTGRNGKNNGKGYYIYEKGSKPKPDPSILPIV
EESRRLCNIMPNGKPISVTDQEIVEMVLFPVVNEACRVLDEGIVIRASDLDVASVLGMSF
PNYRGGIVCWADLVGANHVYTSLKKWAQLYGNFYKPSRYLEERAIKGIPLSAPASSTPKS
KSRL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcgttggctaaggttgattttgaggttggaagtgatggggttgctgtcatcactatg
tgcaacccacccgtgaatgctttggctattccaattatcaaggggttgaaagacagattt
gacgaggcagctaggaggaacgatgtgaaagctatagttttgactggcaaaggtgggaga
ttttctggtggctttgatatcagtgttatgaagaaggttcaccaaactggggatgtctcg
cttgtgcctgatgtgtcggtggaactagttgtcaattcaatagaagattcgaagaagcca
gttgttgcggctgtggaggggcttgctcttggcggtggcttagaactggccatgggatgc
catgcacgtattgcggttccgagaactcaactgggtctgccagagctgtctcttggtatt
attcccggatttggaggaacacaacgtcttccaaggcttcttgggctgtctaaagctgtt
gaaatgatgctgacatctaaaccgatcacatcagatgaagggaggaaattaggacttatt
gatgcaattgtgtcttctgaggagttactaaaggtatctaggttgtgggcacttgaaatt
ggagagaggcgcaaaccttggattcgttcgcttcacaagacagacaaaattggttccctg
tctgaagcgcgtgaggtgttgagtactgccaggcaacaagtcaagaagactgctccacat
ttgcctcagcagcaggcttgcatagatgtgattgaacatggaattgtccatgggggctat
agtggtgttctaaaggaggcagaagtattcaagcaattagtcatgtctgacacctcaaaa
ggtttaattaatgtcttctttgctcagcgggcaatatcaaaggtgccaggtgtaactgat
attggccttaagccaacaaatgtgaaaaaagctgcagtcattggaggaggtttgatgggt
tctggcattgctacagctcttatactaggcaacattcgtgttgtactcaaggaaataaat
tctgaatttcttcttaagggaattaagacaatagaaacaaatgttagtggcttagtaaga
agaggaaagttgacaaaacagaaggcagatgctgcactgtcactgcttaaaggcgttctg
gattacacagagtttaaagatgtggacttggtcattgaggctgtaattgaaaatgtcagt
ctcaaacaaactatatttagtgatcttgagaagatctgtcctccacactgtattttagca
tcaaacacatcaactattgaccttaatgttgttggtaaaaagaccagctctcaagatcgt
attgtgggtgctcattttttcagtcctgcccacattatgcctcttttggagattatacga
actgagaaaacttctgcacaagtgattcttgatctgataaacgttggtaaaatcataaag
aaggctcctgttgtggtgggtaactgcactggctttgcagtgaacagaacattcttccca
tattcacaaggtgcccatttattggtcaacttgggcgtggatgtttacagaatcgacaga
ttgataagcaatttcggccttcccatgggtcctttccagcttcaagacttggctggctat
ggagttgccgttgctgttgcaaaagaattttctggttcattttctgatcgcatatttaaa
tctccactgcttgatcttctaatcaaaactgggcgaaatggtaaaaacaatgggaaaggg
tactacatttatgaaaagggtagcaagccaaaacctgatccttcaatactgccaatagtc
gaggagtctagaagactttgcaatattatgcccaatggaaagcctatatctgttactgac
caagagatcgtggaaatggtactgttcccagtagtgaatgaggcgtgccgtgtcttagac
gaaggaattgttattcgagcatcagaccttgacgttgcatctgttcttggaatgagcttc
ccgaattaccggggtggcattgtttgctgggcagatttggttggggctaatcatgtatat
accagcctaaaaaaatgggcacaattatatggtaacttctataagccctcaaggtatttg
gaagaaagagcgatcaaaggcattcctttgagtgcacctgcttcatctactccaaagtca
aagtctcgtctatga

KEGG   Cajanus cajan (pigeon pea): 109807955Help
Entry
109807955         CDS       T04868                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein MFP2-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00592  alpha-Linolenic acid metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01212  Fatty acid metabolism
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109807955
   00592 alpha-Linolenic acid metabolism
    109807955
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     109807955
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     109807955
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     109807955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 RNA_pol_Rpb1_4
Motif
Other DBs
NCBI-GeneID: 109807955
NCBI-ProteinID: XP_020226302
LinkDB All DBs
Position
11
AA seq 719 aa AA seqDB search
MGHTLIEVGRDGVAIITIVNPPVNSLSFDVLRSLKESFDQALRRNDVKAIVVTGAKGKFS
GGFDISAFGGLQEAKERPKPGYISVEIISDTIEAARKPSVAAIDGLALGGGLEVAMACSA
RLSTPTALLGLPELQLGIIPGFGGTQRLPRLVGLTKALEMMLTSRPVKGKDAFNLGLVDG
LVSPDDLVNTARQWALDILGHRRPWIASLHKTDKLEPLGEAREILKFARAQARKRAPNLH
HPLVCIDVIEAGVLAGPRAGLWKEAEAFEVLVKSDTCKSLVHIFFAQRGTSKVPGVTDRG
LVPRHVKKVAILGGGLMGSGIATALILSNYPVILKEVNQKFLDAGINRIKANLQSRVKKG
KLTQQNFEKAISLLKGTLEYKSFKDVDMVIEAVIENVSLKQQIFADLEKYCPPHCILASN
TSTIDLDLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTKQTSPQVIVDVLDISKKIKKT
PVVVGNCTGFAVNRMFFPYAQAGLLLVERGADVYQIDKVITKFGMPMGPFRLADLVGFGV
AIATGMQFIQNFPERTYKSMLIPLLQEDKRAGETTRKGFYLYDDKRKAIPDPELKNYIEK
ARSITGVSVDPQLVKLQERDIIEMIFFPVVNEACRVLDEGIAVKAADLDISAVMGMGFPP
YRGGIIFWADSLGSKYIYSRLESWSQLYGEFFKPCAYLASRAAKGIPLSASVEQAKARL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgggacacacgctcatcgaggttggacgcgacggcgttgccatcatcaccatcgtcaat
cctcccgtcaattccctctccttcgatgtattgcgcagtttaaaggagagttttgatcag
gctctacggagaaatgatgtcaaggcaattgttgttacaggtgcaaagggaaaattttct
ggaggttttgatatttctgcatttggtggtcttcaagaggcgaaagagcgtccaaagcct
ggttatatatcagtagaaatcatcagtgatactattgaagctgctaggaaaccatcagtt
gctgccattgatggccttgccttgggtgggggcttagaagttgcaatggcatgcagtgct
cggttatcaaccccaactgctctactaggcttgcctgaacttcagcttggaataattcct
ggatttggaggaacacagcgacttcctcgtcttgttggtttgacaaaggcacttgagatg
atgctgacttcaagaccagttaaagggaaggatgcttttaatttggggcttgtagatggt
ttggtgtcacctgatgacttggtgaacactgcacgccagtgggccctggatatcttgggc
caccgacgaccatggattgctagtcttcataagactgacaaattggaaccccttggggaa
gcaagagagattttgaaatttgcacgagctcaggctcgaaaacgggctcctaacctccat
catcctttggtttgcattgatgttattgaagcaggagtacttgctggaccccgagcaggg
ctctggaaggaagctgaagcatttgaagtgcttgtaaagtcagatacttgcaaaagctta
gttcacatattttttgctcaaagaggaacatctaaggtacctggcgttactgatcgtggt
ctggttccaagacacgtcaagaaggttgctatccttggtggaggactaatgggctctggc
atagcaacagctttaatccttagcaactatcctgtcatcttgaaagaagtaaatcagaag
ttcttggatgctggtatcaataggattaaagcaaacttacagagccgtgttaagaaaggt
aaattgactcagcaaaattttgaaaaagccatctctcttctcaaaggtactcttgaatat
aagagcttcaaagatgtggacatggttatagaggctgttattgagaatgtttccttaaag
caacagatatttgctgatcttgaaaagtattgtccacctcattgtatacttgcaagtaac
acttccacaattgacttggaccttattggagagaggaccaagtctcaagatcgaattgtg
ggagcccatttcttcagtcctgcacacgttatgccacttctggaaattgtacgtactaag
cagacctctccccaagtgatagttgacgtgttagatatttcaaagaagataaagaaaact
ccagtggtggttggaaactgcacaggatttgctgttaatcggatgttctttccatatgcg
caagcaggtctcttgcttgttgaacgtggtgccgatgtttatcaaattgataaagtaata
accaaatttggaatgcccatggggccattcagattggctgacctcgttgggtttggtgtg
gcgattgctactggcatgcaatttattcagaattttcctgagcgaacttataaatcaatg
cttattccactcctgcaagaagataagagagctggcgaaacaactcgcaaaggattttac
ttgtatgatgataaacgcaaggctattcctgatcctgaattgaaaaactacatcgagaag
gctcggagcattactggtgtctcagttgatcctcagcttgtcaaattacaagaaagggat
atcatagagatgatattctttcctgtggtgaatgaggcttgtcgggtccttgatgaaggt
attgcagtcaaagcagcagatctcgatatttctgcagtcatgggcatgggttttccacct
tacaggggaggtatcatattctgggctgactctcttggatccaagtacatatattcaaga
ttggagagctggtcacagttgtatggagaattcttcaagccttgtgcctacttggcttca
agagctgccaaaggaattcctctgagtgcctcggtggagcaggcaaaggcgcggttgtaa

KEGG   Cajanus cajan (pigeon pea): 109809413Help
Entry
109809413         CDS       T04868                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein MFP2-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00592  alpha-Linolenic acid metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01212  Fatty acid metabolism
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109809413
   00592 alpha-Linolenic acid metabolism
    109809413
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     109809413
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     109809413
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     109809413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 109809413
NCBI-ProteinID: XP_020228309
LinkDB All DBs
Position
11
AA seq 716 aa AA seqDB search
MGHTVMEVGPHGVAIITIVNPPVNSLSYDVFHSLKENFDQAIQRDDVKAIVFTGAKGRFS
GGFDISAFGGGKERPKAGWLSVEIITDTIEAARKPLVAAIDGLALGGGLELAMACNARLS
TPTAQLGLPELQLGIIPGLGGTQRLPRLVGLTKALEMILTSKPVKGKEAFSLGLVDGLVS
PDDLVNAACQWALDILGHRRPWIASLYKTDKLEPLGEAGEILKFARAQAQKRAPNLQHPL
VCIDVIEVGVVSGPRAGLWKEAEASQGLGASDTCKSLVHIFFAQRGTSKIPGVTDCGLVP
RQVKNIAILGGGLMGSGIATALILSSYAVILKEVNEKFLDAGINRIKANLLSRVKKGKLT
QDKFEKAISLLKGTLDYESFRDVDMVIEAVIENVSLKQHIFADLEKYCPPHCILASNTST
INLNLIGKRTKSQDRIVGAHFFSPAHVMPLLEIVRTKQTSPQVIVDVLDISKKIKKIPVV
VGNCTGFAVNRMFFPYTQAGLLLVERGADVYQIDKVITKFGMPMGPFRLADLVGFGVAIA
TGMEFIQNFPERTYKSMLIPLLQEDKRAGETTRKGFYLYDDKRKASPDPELKNYIEKARS
ITGVSLDPKLVKLQEKDILEMIFFPVVNEACRILDEGIAVKAADLDICAVMGMGFPPYRG
GIIFWADTLGSKYIYSRLERWSELYGEFFKPCAYLAARAAKGIPLSAYVEQAKSRL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgggacacacggtgatggaggttggacctcacggcgttgccatcatcaccatcgtcaac
cctcccgtcaattctctctcctacgatgtattccacagtttaaaggagaattttgatcag
gctatacagagagatgatgtcaaggcaattgtttttacaggtgcgaagggaagattttct
ggaggttttgatatttctgcatttggtggtgggaaagagcgtccaaaagctggttggtta
tcagtagaaatcatcactgatactatagaagcggctaggaaaccattggttgctgccatt
gatggccttgccttgggtgggggcttggaacttgcaatggcgtgcaatgctcggttatca
accccaactgctcagctaggtttgcctgaacttcagcttggaataattcctggattagga
ggaacacagcgacttcctcgtcttgttggtttgacaaaggcacttgagatgatactgact
tcaaaaccagttaaagggaaggaagcttttagtttgggacttgtggatggtttggtgtca
cctgatgatttggtgaacgctgcatgccagtgggccctggatatcttgggccaccgacga
ccatggattgctagtctttataagactgacaaattagaaccccttggagaagcaggagag
attttaaaatttgcacgagctcaggctcaaaaacgagctcctaacctccaacatcctttg
gtttgcatcgatgttattgaagtaggagtagtttctggtccccgtgcaggactctggaag
gaagctgaagcatctcaaggacttggagcgtcagatacttgcaaaagcttagttcatata
ttttttgctcaaagaggaacatccaagatacctggggttacggattgtggtctggttcca
agacaagtcaagaacattgccatccttggtggaggactaatgggctctggaatagccact
gctttaattcttagtagctatgctgtcatattgaaagaagtaaacgagaagttcttagat
gctggtatcaataggattaaagcaaacttactgagccgtgttaagaaaggcaaattaacc
caggataagtttgaaaaggccatctctcttctcaaaggtacccttgactatgaaagcttc
agagatgtggacatggtgatagaggctgttattgagaatgtttccttaaagcaacatatc
tttgctgatcttgaaaagtattgtccacctcattgtattcttgcgagtaacacttccaca
attaacttgaacctgattggaaagaggaccaagtctcaagatcgaattgttggagcccat
tttttcagtcctgcacatgttatgccacttctggaaatagtacgtaccaagcagacctct
cctcaagtgatagttgacgtgttagatatttcaaagaagataaagaaaattccagtggtg
gttggaaactgcacaggatttgctgttaatcggatgttctttccatatacgcaagcaggt
ctcttgcttgttgaacgtggtgcagatgtttatcaaattgataaagtaataaccaaattt
ggaatgcccatggggccattcagattggctgacctcgttgggtttggcgtggcgattgct
actggtatggaatttattcagaattttcctgagcgaacttataaatcaatgcttattccc
cttctgcaagaagataagagagctggcgaaacaactcgcaaagggttttatttgtatgat
gataaacgcaaggctagtcctgatcctgaattgaaaaactatattgagaaggctaggagc
atcactggtgtctcccttgatcctaagcttgtcaaattacaagaaaaggatatcttagag
atgatattctttcctgtggtgaatgaggcttgtcggatccttgatgaaggtattgcagtc
aaagcagcagatctcgatatttgtgcagtcatgggcatgggttttccaccttacagggga
ggtatcatattctgggctgacactcttggatccaagtacatatattcaagattggagaga
tggtcagagttgtatggagaattcttcaagccttgtgcctacttggctgcaagagctgca
aaaggaattcctctgagtgcctatgtggagcaggcaaagtcacggttgtaa

DBGET integrated database retrieval system