KEGG   Cajanus cajan (pigeon pea): 109800244Help
Entry
109800244         CDS       T04868                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00410  beta-Alanine metabolism
ccaj00592  alpha-Linolenic acid metabolism
ccaj00640  Propanoate metabolism
ccaj01040  Biosynthesis of unsaturated fatty acids
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109800244
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109800244
   00592 alpha-Linolenic acid metabolism
    109800244
   01040 Biosynthesis of unsaturated fatty acids
    109800244
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109800244
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109800244
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     109800244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 109800244
NCBI-ProteinID: XP_020216597
LinkDB All DBs
Position
6
AA seq 665 aa AA seqDB search
MEDGVDHLAFERSKAQFDVDEMKIVWAGSRQEFELSDRISRLVASDPAFRKDDRITLDRK
ELFKNTLRKAAYAWKRITELRLNEQEAYKLRSFVDQPAFTDLHWGMFVPAIQGQGTEEQQ
QKWLPLAYKMQIIGCYAQTELGHGSNVQGLETTATFDPKTDEFIIHSPTLTSSKWWPGGL
GKISTHGVVYARLIIDGQDHGVHGFIVQLRSLDDHYPLPGITIGDIGMKFGNGAYNTMDN
GLLRFDHVRIPRNQMLMRVSQVTREGKFVHSDVPRQLVYGTMVNVRQKIVSDASVALSRA
VCIATRYSAVRRQFGSHNGGLETQVIDYKTQQARLFPLLASAYAFRFAGEWLKWLYRDVT
ERLQANDFSTLPEAHACTAGLKSLTTTATADAIEECRKLCGGHGYLCSSGLPELFAVYVP
ACTYEGDNTVLLLQVARHLMKTISQLGSGRKPVGTTAYMGRLDQLTQYHSDVKKAEDWLK
PNVVLEAFEARAARMSVACAQNLSKFANPEEGFQELLADLAEAAVAHCQLIVVSKFIEKL
QQDIPGKGVRQQLEVLCSIYALSLLHKHLGDFLSTGCINPKQGSLASEQLRYLYSQVRPN
AIALVDAFNYTDHYLGSILGRYDGNVYPKLYEEAWKDPLNDSVVPDGFKEYVQPMLKQQL
RNARL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggaagatggcgttgaccacttggctttcgagaggagcaaggcgcaattcgatgtggac
gagatgaaaatcgtttgggcaggttctcgccaagagtttgagctctccgatcggatttct
cgccttgtcgccagcgatcctgcgttcagaaaggatgacagaatcacgcttgatagaaag
gagttatttaagaacactttgagaaaagcagcttatgcatggaagaggataactgagctc
cgtcttaatgaacaagaggcttataagctcaggtccttcgtggatcaacctgcatttacg
gatcttcattggggaatgtttgtgcctgctatccaaggacaaggcactgaggagcagcag
cagaagtggttgcctctagcttataagatgcaaataattggttgctatgcccaaactgaa
cttggtcatggatccaatgttcaagggctagaaacaactgcaacatttgatcccaaaaca
gacgagtttattatccatagccccacattgacttccagcaaatggtggcctggtggattg
ggaaaaatatccacgcatggtgttgtttatgcccgtttaattattgatggtcaagaccat
ggggtgcacggtttcattgtccagctgaggagcttggatgatcactatcctcttccaggc
ataactattggtgatattgggatgaaatttggaaatggagcgtataacaccatggataat
ggacttctgagatttgatcatgtacgaattccaaggaatcaaatgttgatgagggtttca
caggtgaccagagaaggaaaatttgtgcactctgatgttccaagacaattagtttatggt
actatggtaaatgtgagacaaaagattgtgtctgatgcatcggttgctttgtctcgagca
gtttgcattgctacaagatatagtgctgttcgaagacagtttggatcacataatggaggt
ctagaaacacaagtgattgattacaaaacgcagcaggctaggctcttccctttgctggct
tctgcttatgctttcagatttgctggtgagtggctgaaatggctttacagggacgtgacg
gaaagattgcaagctaatgatttttcaacattgcctgaggctcatgcatgcaccgcaggg
ttgaaatccttgactactacggcaactgctgatgcaattgaagaatgtcgtaaattatgc
ggtggtcatggttatctttgtagcagtggtctccctgagttatttgcagtttatgttcct
gcctgcacgtacgaaggagacaatactgtgttgcttctacaggtggcaaggcatctcatg
aagactatttctcagctgggctctggacgtaagcctgttggtactacagcttacatgggt
cgattggaccaactgacgcaatatcactctgatgttaaaaaagctgaggattggctgaag
ccaaatgtagtgttggaagcttttgaagccagggctgctaggatgtctgttgcttgtgct
caaaatcttagcaagttcgctaatcctgaagagggttttcaagaactcttggctgattta
gctgaggcggcagttgctcattgccagttaattgttgtttccaaatttattgagaagttg
cagcaagatatacctggaaagggagtgagacagcaattagaagttctttgcagcatttat
gctttgtctctacttcacaagcatctgggtgattttctttccactggctgcataaaccca
aaacaaggatcactcgccagtgagcaactgagatacttgtattcacaggttcgtcccaac
gcaattgcgcttgttgatgcattcaattacaccgatcactaccttggttcaattcttggg
cgttacgatggaaatgtgtatccgaagttgtacgaggaggcatggaaggatcctctgaat
gattcagttgttcctgatggctttaaagagtatgttcaaccgatgcttaagcaacaacta
cgtaatgctagactatag

KEGG   Cajanus cajan (pigeon pea): 109806563Help
Entry
109806563         CDS       T04868                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal-like
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00410  beta-Alanine metabolism
ccaj00592  alpha-Linolenic acid metabolism
ccaj00640  Propanoate metabolism
ccaj01040  Biosynthesis of unsaturated fatty acids
ccaj01200  Carbon metabolism
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109806563
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    109806563
   01040 Biosynthesis of unsaturated fatty acids
    109806563
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109806563
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109806563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 109806563
NCBI-ProteinID: XP_020224596
LinkDB All DBs
Position
10
AA seq 283 aa AA seqDB search
MSFAANELKMMYVNRTPESNKTIHIISSAYKATLTWNNMHTLQECREACGGQGIKSENRV
GQFMGEFDVQSTFEGDNNVLMQQISKALFAEYVACQKKNKPFSGLGLEHMNKPFPIIPSQ
LTSSTIRSSEFQIDLFHLRERDLLRRFAEEVLERQSLGESKESTFILSYQLAQDLGRAFS
ERAILKTFMEAESTLPAGSLKDVLGLLRSMYAVICVDEDASFLRYGYLSTENASAVRKEV
PKLCAELRPHALALVSSFGIPDAFLSPIAYNWIDSNSWSSSQL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgctgcaaatgagctcaaaatgatgtatgtcaatagaacgcctgagtcaaac
aagacaattcatattatttctagtgcttacaaggctactttaacttggaataatatgcat
actctccaggaatgtcgtgaagcctgtggaggacaaggaattaaatctgaaaatcgtgtc
ggtcaattcatgggtgaatttgatgtgcaatcgacatttgagggggacaacaatgttctg
atgcagcagattagcaaggcactctttgcagaatacgtagcatgtcagaagaaaaataag
ccattcagtggtttgggattagaacacatgaacaaaccttttcctattatcccatcccag
ttaactagttccaccattaggagcagtgaatttcagattgatctgttccacctaagagag
cgagacctattgagacgttttgctgaagaggttttagaacgtcaatctcttggagaaagc
aaagagtctaccttcattttaagttatcagctcgcacaagacttgggcagagctttctca
gaacgagcaatattaaaaacgttcatggaggcagagtcaactttaccagctggttcattg
aaggatgtcttgggactgttgagatcgatgtatgctgtgatatgtgtggatgaagatgct
tcctttcttcgatatggatacttgtcaacagagaatgcttctgcagtgaggaaagaagtg
ccaaaactctgtgctgaacttcgcccgcatgcacttgccttggtcagttcctttggtatt
cccgatgctttcttgagcccaatcgcgtataattggatcgattcaaattcttggtcttct
tctcaactttag

KEGG   Cajanus cajan (pigeon pea): 109809855Help
Entry
109809855         CDS       T04868                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00410  beta-Alanine metabolism
ccaj00592  alpha-Linolenic acid metabolism
ccaj00640  Propanoate metabolism
ccaj01040  Biosynthesis of unsaturated fatty acids
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109809855
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109809855
   00592 alpha-Linolenic acid metabolism
    109809855
   01040 Biosynthesis of unsaturated fatty acids
    109809855
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109809855
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109809855
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     109809855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 109809855
NCBI-ProteinID: XP_020228849
LinkDB All DBs
Position
11
AA seq 665 aa AA seqDB search
MEGVVDHLAFERNKAQFDVEEMKIVWAGSRQALEISDKMARLVASDPVFKKDNRAMLDRK
ELFKNTLRKTAYAWKRIIELRLSEQEAAMLRFFVDQPAFTDLHWGMFVPAIKGQGTEEQQ
QKWLPLAYKMQIIGCYAQTELGHGSNVQGLETTARFDPKTDEFVIHSPTLTSSKWWPGGL
GKVSTHGIVYARLITDGRDYGVHGFIVQLRSLDDHLPLPGITVGDIGMKFGNGAYNSMDN
GVLRFDHVRIPRNQMLMRVSQVTREGKYVQSNVPRQLVYGTMVFVRQTIVSDASTAMSRA
VCIATRYSAVRRQFGSNNGGIETQVIDYKTQQARLFSLLASAYAFRFVGEWLKWLYMDVM
KRLQANDFSTLPEAHACTAGLKSLTTSATADGIEECRKLCGGHGYLCSSGLPELFAVYVP
TCTYEGDNTVLLLQVARHLLKTISQLGSGKKPVGTTSYIGRVEQLMRYRSNVQKGEDWLN
PNAVLGAFEARAAKKVVLCAQNLSRFTNPEEGFQELSVDLVEAAVAHCQLIVVSKFIEKL
QQDIPGKGVKQQLEVLCSIYALSLLCKHLGEFLSTGSINPKQASLANDQLRSLYSQVRPN
AVALVDAFNYTDHFLGSVLGRYDGDVYPKLYEEAWKDPLNDSVVPDGYQEYVRPMLKQQL
RNARL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcgtggttgatcacttggcgttcgagaggaacaaggcgcaattcgacgtcgaa
gagatgaagatcgtttgggcgggttctcgtcaggctcttgaaatctctgacaaaatggct
cgcctcgttgccagtgatcctgtgttcaaaaaggataatagagctatgcttgataggaag
gagttgtttaagaacacattgaggaaaacagcttatgcgtggaaaaggataattgagctt
cgtctcagtgaacaggaagctgctatgcttagattctttgtggaccaacctgcttttacg
gatctgcattggggaatgtttgttcctgctattaaaggacaaggaactgaggaacaacaa
caaaagtggttgcctttggcttataagatgcaaataattggttgctatgcccaaactgaa
ctgggacatggatctaatgttcaagggctagaaacaactgcaaggtttgatcctaaaaca
gacgagtttgtaattcacagccccacattgacttccagcaaatggtggcctggtggattg
ggtaaagtgtcaacacatggtattgtttatgcccgactaattactgatggtcgagattac
ggagtgcatggattcattgtccagctgcgtagcttggatgatcatttacctcttccgggc
ataactgttggtgatattggaatgaaatttggaaatggagcatataactccatggataat
ggtgttttaaggtttgaccatgttcgaattccaagaaatcaaatgttaatgagagtttca
caggtaacaagggaaggaaaatatgtgcaatccaatgttccacgacaattagtttatggt
actatggtatttgtaagacaaacaattgtatctgatgcatcaacagctatgtcgcgagca
gtttgcattgctacaagatatagtgctgttcgaagacagtttgggtcaaataatggaggt
attgaaacacaggtgattgattataaaacgcagcaagctaggctcttctctttgttagct
tctgcctatgccttcagatttgttggcgaatggttgaaatggctttatatggatgtgatg
aaaagattgcaagccaatgatttttcaacattacccgaggctcatgcatgcactgcaggg
ttgaagtccttgactacttcagcaactgctgatggaattgaagaatgccgcaaattatgt
ggtggccatggttacctctgtagcagtggtctccctgagttatttgcagtgtatgttcca
acctgcacatatgaaggagacaacactgtgctgcttttacaggtggcaagacatctcctg
aagactatttcacagttgggctctggaaaaaagcctgtcggtacaacatcttatattgga
cgtgtggaacagctgatgcgatatcgttctaatgtacagaaaggggaggattggttgaat
cctaatgcagtgctgggagcatttgaagctagggctgctaagaaggtggttctttgtgct
caaaatcttagcaggtttaccaatcctgaagaaggtttccaagaactctcggttgatcta
gttgaggcagctgttgctcattgccagttaattgttgtatccaaatttattgagaagttg
cagcaagatattcctggaaagggagtgaaacagcaattagaagttctctgtagcatttat
gctttgtctcttctttgtaagcatttgggtgagtttctttcaactggcagcatcaatcca
aaacaggcttcccttgcaaatgatcaactgaggtccttgtattcacaggttcgtcctaat
gcagttgcacttgttgatgcgtttaactacaccgatcacttccttggttcggttcttggg
cgttatgatggagatgtgtatccaaagctgtacgaggaggcatggaaggatccattgaat
gattcagttgtgccagatggctatcaagaatatgttcgaccaatgctaaagcaacaactt
cgtaatgcaagactctaa

KEGG   Cajanus cajan (pigeon pea): 109810587Help
Entry
109810587         CDS       T04868                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00410  beta-Alanine metabolism
ccaj00592  alpha-Linolenic acid metabolism
ccaj00640  Propanoate metabolism
ccaj01040  Biosynthesis of unsaturated fatty acids
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109810587
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109810587
   00592 alpha-Linolenic acid metabolism
    109810587
   01040 Biosynthesis of unsaturated fatty acids
    109810587
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109810587
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109810587
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     109810587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_M Acyl-CoA_dh_1 ACOX Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 109810587
NCBI-ProteinID: XP_020229675
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MVMGMFELRKLALFEVIGMYDHSLAVKLGVHFFLWGGAVKFLGTKHHHDKWLSSTENYEI
KGCFALSELGHGSNVRGIETVATYDSNTGEFIINTPCESGQKYWIGGAANHATHTIAFSQ
LHINGSNQGVHAFIVQIRDSDGNICPNIRIADCGHKTGLNGVDNGRIWFDNVRIPRENLL
NSVADVSPSGEYLSAIKNADQRFAAFLAPLTRGRVTICVSAVYISKISLAIAIRYALTRQ
AFSITPNGPEVLLLDYPTHQRRLLPLLAKVYAMSFAANELKMMYVNRTPESNKTIHIISS
AYKATLTWNNMHTLQECREACGGQGIKSENRVGQFMGEFDAQSTFEGDNNVLMQQISKAL
FAEYVACQKKNKPFSGLGLEHMNKPLPIIPSQLTSSTIRSSEFQIDLFHLRERDLLRRFA
EEVLERQSLGESKESTFILSYQLAQDLGRAFSERAILKTFMEAESTLPAGSLKDVLGLLR
SMYAVICVDEDASFLRYGYLSTENASAVRKESAKTLC
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgggtatgtttgagctgaggaagctcgcgctatttgaggttattgggatgtat
gatcactccctcgctgttaagcttggcgttcatttcttcttgtggggtggggctgtaaag
tttctgggaaccaagcatcatcacgacaagtggttgagttctactgaaaactatgagatc
aagggttgctttgctttgtctgagttgggccatggaagtaatgttcgagggattgaaaca
gttgctacttatgattcgaacactggagaatttataatcaatactccatgtgaatcgggt
cagaagtattggattggtggtgcagcaaatcatgcaacacacactatagccttttcacag
ctccatataaatggaagcaatcaaggggtgcacgcatttattgtccaaatcagggattcc
gacggaaacatatgtccaaacatccgaatagctgattgtggtcacaaaactggtttaaat
ggagttgataatggccgtatctggtttgataatgtgaggatacccagagagaatttgttg
aattcagtggctgatgtttcaccaagtggtgaatatctgagtgcaataaaaaatgcagat
cagaggtttgccgcgttcttggctccattgaccaggggtcgtgttactatttgtgtcagt
gctgtttacatatccaagattagcttggccattgccataagatatgcattgacaaggcag
gcattctccattacaccaaatgggcctgaagttttactgcttgattaccctactcatcaa
cggcgtctgttacctttactagcaaaggtatatgcaatgagttttgctgcaaatgagctc
aaaatgatgtatgtcaatagaacgcctgagtcaaacaagacaattcatattatttctagt
gcttacaaggctactttaacttggaataatatgcatactctccaggaatgtcgtgaagcc
tgtggaggacaaggaattaaatctgaaaatcgtgttggtcaattcatgggtgaatttgat
gcgcaatcgacatttgagggggacaacaatgttctgatgcagcagattagcaaggcactc
tttgcagaatacgtagcatgtcagaagaaaaataagccattcagtggtttgggattagaa
cacatgaacaaacctttgcctattatcccatcccagttaactagttccaccattaggagc
agtgaatttcagattgatctgttccacctaagagagcgagacctattgagacgttttgct
gaagaggttttagaacgtcaatctcttggagaaagcaaagagtctaccttcattttaagt
tatcagctcgcacaagacttgggcagagctttctcagaacgagcaatattaaaaacgttc
atggaggcagagtcaactttaccagctggttcattgaaggatgtcttgggactgttgaga
tcgatgtatgctgtgatatgtgtggatgaagatgcttcctttcttcgatatggatacttg
tcaacagagaatgcttctgcagtgaggaaagaaagtgccaaaactctgtgctga

KEGG   Cajanus cajan (pigeon pea): 109813631Help
Entry
109813631         CDS       T04868                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00410  beta-Alanine metabolism
ccaj00592  alpha-Linolenic acid metabolism
ccaj00640  Propanoate metabolism
ccaj01040  Biosynthesis of unsaturated fatty acids
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109813631
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109813631
   00592 alpha-Linolenic acid metabolism
    109813631
   01040 Biosynthesis of unsaturated fatty acids
    109813631
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109813631
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109813631
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     109813631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 109813631
NCBI-ProteinID: XP_020233442
LinkDB All DBs
Position
Unknown
AA seq 437 aa AA seqDB search
MTIFSSPNSDGSVKNTMPSYFYSPPLDVSVAFPQATPASLFPPCASDYFQLDDLLTQEER
AIKKKVRECMEKEISPIMTEYWEKAKFPFHVIPKLGALRIAGGTIKGYGCPGLSITGSAI
TMAEVARVDASCSTFILVHSSLAMLTIALCGSEAQKQKYLPSLAQLQTIACWGLTEPDYG
SDASALKTTATKVDGGWILEGQKRWIGNSTFADVLVIFARNATTNQINGFIIKKDAPGLT
VTKIENKIGLRIVQNGDIVMRKVFVPDEDRIAGVNSFQDTSKVLAVSRVMVAWQPIGISM
GIYDMCHRYLKERKQFGAPLAAFQISQLKLVQMLGNIQAMILVGWRLCKLYESGKMTPGH
ASLGKSWITLRARETAALGRELLGGNGILADFLVAKAFCDLEPIYTYEGTYDINTLITGR
EVTDFASFKPVAQRSRL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcttctcttctcccaattcagatggttctgtcaaaaatacaatgccttcttat
ttttattcaccaccactagatgtttctgtagcatttccacaagcaactccagcatcattg
tttcctccttgcgcttcagattattttcaattggatgacttattgacacaggaggagcgc
gccattaagaagaaagtcagagaatgtatggaaaaagaaatttctccaataatgactgag
tactgggagaaggccaagttcccatttcatgttattccaaagcttggtgcattgcgcatt
gctggtggcacaatcaagggttatggttgtcctggcctttctatcactggaagtgctata
actatggcagaagttgcaagagttgatgcaagctgttcaacttttattttggtccattca
tccttggcaatgctcactattgcattgtgtggatcagaagcccagaagcaaaagtatctg
ccttctttggcacagttgcaaactatagcatgctggggtttgactgaacctgactatgga
agtgatgcaagtgctttgaagaccactgctacaaaggtggacggaggttggattctggag
ggacaaaagcggtggataggaaacagtacatttgctgatgtattggttatctttgctagg
aatgcaacaacgaatcagataaatgggtttattattaaaaaggatgcacctggtttaaca
gtcacaaaaatagagaataaaattggacttcggatcgtacaaaatggagacattgttatg
agaaaagtttttgtccctgatgaggacagaattgcaggtgtaaactcttttcaggacaca
agcaaggtacttgctgtttcacgtgtaatggttgcttggcaacccattggtatatcgatg
ggcatctatgatatgtgtcataggtacctaaaggagaggaaacaatttggagcaccattg
gcagctttccaaatcagccaactgaaacttgtccagatgcttggtaatattcaagctatg
attcttgttggttggcgcctctgcaaattgtatgagagtggtaaaatgactccagggcat
gctagtttggggaagtcatggattaccttgagagcaagagaaacagctgctctggggcga
gaattgcttggtggcaatggaattttggccgattttcttgtggcgaaggcattctgtgat
ttagaacccatctatacctacgaaggcacgtatgacatcaacaccctgattacaggcagg
gaagttactgattttgccagctttaagccagttgctcagagaagtcgattgtaa

KEGG   Cajanus cajan (pigeon pea): 109815394Help
Entry
109815394         CDS       T04868                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00410  beta-Alanine metabolism
ccaj00592  alpha-Linolenic acid metabolism
ccaj00640  Propanoate metabolism
ccaj01040  Biosynthesis of unsaturated fatty acids
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109815394
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109815394
   00592 alpha-Linolenic acid metabolism
    109815394
   01040 Biosynthesis of unsaturated fatty acids
    109815394
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109815394
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109815394
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     109815394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 109815394
NCBI-ProteinID: XP_020235700
LinkDB All DBs
Position
Unknown
AA seq 433 aa AA seqDB search
MSRADQDNANRKMPSYFDLPPLDVSVAFPQATPASTFPPCVSDYFHLNDLLKPEEQAVRN
KVRECMEKEIAPIMTQYWEKAEFPFQVIPKLAALRIAGGTIKGYGCPGFSITGNAVAAAE
VARVDASCSTFILVHSSLAMLTIALCGSEAQKQKYLPSLAQLQTIACWALTEPEYGSDAS
ALKTTATKVDGGWIIEGQKRWIGNSTFADLLVIFARNTTTNQINGYIVKKDAPGLTVTKI
ENKIGLRIVQNGDIVLRKVFVPDDDRIEGVNSFQDTNKVLAVSRVMVAWQPIGISMGIYD
MCHRYLKERKQFGAPLAAFQISQQKLVQMLSNVQAMILVGWRLCKLYESGKLTPGRASLG
KSWITLRARETAALGRELLGGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREVTG
FASFKPVAQRSRL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgccgatcaagataatgcgaataggaagatgccttcgtattttgatttgcca
cctcttgatgtttctgtggcatttccacaggccactccagcctccacttttcctccttgt
gtttcagattattttcatctcaacgacttattgaaaccggaggagcaggcagttaggaac
aaagtgagagagtgtatggaaaaagaaattgctcccataatgacccagtactgggagaag
gctgaattcccatttcaagtcatcccaaagcttgctgccctgcgtattgctggtggcaca
attaagggttatggttgtcctggtttttccataactggaaatgctgttgctgcagcagaa
gttgctagagttgatgcaagctgttcaactttcattttggtccattcttccttggcaatg
ctcactattgcattgtgtgggtctgaagctcagaagcaaaagtatctaccttctttggct
caattacaaactatagcatgttgggctttgactgaacctgaatatggaagcgatgccagt
gctttgaagacaacagcaacaaaggttgatggtggttggatcattgagggccaaaagcgg
tggataggaaacagtacatttgctgatttgttggttatctttgcaaggaataccacaact
aatcaaataaatggatatattgtcaaaaaggatgcgcctggtttaacagtcacaaaaata
gagaataaaattggacttaggatcgttcaaaatggagacatagttttgaggaaagttttt
gtccctgatgatgacagaatagaaggagtcaattcttttcaagacacaaacaaggtactt
gctgtttcgcgtgtaatggttgcttggcaacctattggtatatcaatgggcatctatgat
atgtgtcataggtatctaaaggagaggaaacaatttggagcaccattagcagctttccaa
atcagtcaacagaaacttgttcaaatgctcagtaacgttcaagcaatgattcttgttggt
tggcgcctgtgcaagttgtatgagagtggcaaactgactccaggtcgtgctagcttgggg
aagtcttggatcaccttgagggcaagagaaacagctgccttggggcgagagttgcttggt
ggcaatggaattttgtctgattttctagtggcgaaggcattctgtgacttagaacctatc
tatacctacgaaggcacgtatgacatcaacaccttggttacaggcagggaagttactggt
tttgccagctttaaaccagttgctcaaagaagtagattgtga

KEGG   Cajanus cajan (pigeon pea): 109816357Help
Entry
109816357         CDS       T04868                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 2, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00410  beta-Alanine metabolism
ccaj00592  alpha-Linolenic acid metabolism
ccaj00640  Propanoate metabolism
ccaj01040  Biosynthesis of unsaturated fatty acids
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01212  Fatty acid metabolism
ccaj04146  Peroxisome
Module
ccaj_M00087  beta-Oxidation
ccaj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109816357
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109816357
   00592 alpha-Linolenic acid metabolism
    109816357
   01040 Biosynthesis of unsaturated fatty acids
    109816357
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109816357
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109816357
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     109816357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 109816357
NCBI-ProteinID: XP_020236927
LinkDB All DBs
Position
Unknown
AA seq 684 aa AA seqDB search
MQTPNSKSNAESASEAERRIRRLSLHLSPVVGVAAKQLEMATCGRGKLSVDTSSLSSYMR
GKHRDVQEKVFAYFNANPHLQTPVEISKDEHRDLCMKQLIGLVREAGIRPLRYVAHEPSK
YFAILEAVGSVDMSLGIKMGVQYSLWGGSVINLGTKKHQDKYFDGIDNLDYPGCFAMTEL
HHGSNVQGLQTVATFDPITDEFIIDTPNDGAIKWWIGNAAVHGKFATVFARLKLPTYDTK
GVSDMGVHAFIVPIRDMETHQPLPGIEIHDCGHKVGLNGVDNGALRFRSVRIPRDNLLNR
FGDVSRDGKYTSSLPTVNKRFAATLGELVGGRVGLAYSSVSVLKVASTIAIRYSLLRQQF
GPPNQPEVSILDYQSQQHKLMPMLASTYAFHFATTNLVEKYSQMKKSHDEELVADVHALS
AGLKAYVTAYTAKSLSICREACGGHGYAAVNRFGILRNDHDIFQTFEGDNTVLLQQVAAD
LLKQYKGKFKGGAFAVTWSYLRESMNTYLSQPNPVTARWEGEDHLRDPKFQLDAFRYRTS
RLLQSVAVRLQKHSKSLGDFGAWNRCLNHLLTLAESHIESVILAKFIEAVESCPDPSSQA
ALKLVCDLYALDRIWNDIGTYRNVDYVAPNKAKAIHKLTEYLSFQVRNIARELVDAFDLP
DHVTRAPIAMRSQAYSQYTQYVGF
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactccaaactccaaatccaatgcggaatcggcctcggaagccgagaggcgaatc
cggaggctgagtctgcacctaagccccgtggtgggcgtggcggcgaagcagttggagatg
gcaacttgcggtcgcgggaagctgagcgtggacacgtcatctctgtcgagttacatgcgg
gggaaacaccgagacgttcaggagaaggtgttcgcttactttaacgcgaatccgcatctt
caaacgcccgttgagatctcgaaggacgagcatcgcgacctttgcatgaagcagttaatt
ggacttgtcagagaagcagggattcgacccctccgttacgtcgcccacgaaccctccaag
tacttcgcaatattggaagccgttggcagcgttgacatgtcgcttggtatcaagatggga
gtccagtatagtctttggggtggttctgttatcaatttggggaccaagaagcatcaggat
aagtactttgatgggatcgataacttggactaccctggttgttttgctatgaccgagctt
caccatggttcaaatgtgcagggtctccaaactgtagccacctttgatccaatcactgat
gaatttatcattgatacaccaaatgatggtgccatcaaatggtggattggcaatgctgca
gtgcatggaaagtttgccacagtttttgctaggttgaaattacccacttatgacacaaaa
ggagtttctgatatgggtgtccatgctttcatagttccaataagggatatggagacccat
caaccacttcctggaattgagatacatgattgtggtcataaagttggcctcaatggtgtg
gataatggagcattgagattccgctctgttagaattcctagagacaatcttctaaaccgt
ttcggagatgtctcccgtgatggaaagtacacaagtagccttcctacagtaaataagcga
tttgctgctactctaggggaacttgttggtggtagggttggccttgcatattcttcagtg
agtgtcctgaaggttgcttccacaattgccatcagatattctctacttcgccagcaattt
ggacctccaaaccaacccgaagtcagtattcttgactaccagtctcaacagcataagctt
atgccaatgctggcttcaacttatgcttttcattttgcaaccacaaatttagtggagaaa
tactctcaaatgaaaaaaagtcacgacgaagaattagttgcagatgtccatgctctttca
gcaggtctaaaggcttatgtaacagcgtatactgcaaagtcactcagcatctgtagggaa
gcttgtggaggccatggttatgctgcggtaaatcgatttggtattttgaggaatgatcat
gacatttttcagacatttgaaggagacaacacagttctgcttcaacaggttgctgccgat
cttttgaaacaatacaaggggaagttcaaaggaggagcttttgcagtgacatggagctac
ttgagagaatccatgaatacttatctgtcacagccaaatccggttactgctcgatgggaa
ggtgaagaccatttacgagatcctaaatttcaactggatgccttcagataccgaacgtct
agattacttcaaagtgttgctgtacgacttcaaaagcattctaaatctcttggggacttt
ggtgcatggaatagatgtttaaaccaccttttgacacttgcagagtcacatattgagtca
gtcatccttgctaaattcattgaagccgtggagagctgtcccgacccaagctcacaagct
gctctgaaactcgtctgtgatctttatgctctggatcgaatatggaatgacattggaacc
taccgaaatgttgactatgtggctcctaataaagctaaggcaatccacaagctcacggag
tatcttagtttccaagtgaggaatattgcaagggaacttgttgatgcatttgatcttccg
gatcatgttacacgtgcccctattgccatgcggtcacaagcttactcacaatacacacaa
tatgtgggattttaa

DBGET integrated database retrieval system