KEGG   Cajanus cajan (pigeon pea): 109800821Help
Entry
109800821         CDS       T04868                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00020  Citrate cycle (TCA cycle)
ccaj00190  Oxidative phosphorylation
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109800821
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109800821
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109800821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 109800821
NCBI-ProteinID: XP_020217301
LinkDB All DBs
Position
6
AA seq 630 aa AA seqDB search
MWRCIARGLRGPASTRSTPNHPLRSHLSRFFSSGVNSSYTVVDHTYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNYGKGGQAYRCACAADRT
GHALLHTLYGQAMRHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQAASTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGIPLEDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDNPDAVVPG
LMAAGETACASVHGANRLGANSLLDIVVFGRACANRVAEVRRPGEKQKPLEKDAGQKTIA
WLDKLRNSNGSLPTSKIRLNMQRVMQSNAAVFRTQETLEEGCQLIDKTWESFHDVKLEDR
SLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFKTRDDENWMKHTVGFWE
NEKVRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcatcgctcgcggacttcgtggacctgcctccaccagatccacccccaac
cacccactccgatctcacctttctagattcttctctagtggggtgaactcttcctacacc
gtggtcgaccatacttacgacgccgtcgtcgtgggtgctggtggcgccggattgagggct
gctattgggctttcggaacatggcttcaatactgcttgtatcaccaagctcttcccaact
cgttcgcacactgttgcagctcagggtggtataaatgctgctttgggaaatatgacggaa
gatgactggaggtggcacatgtatgatactgtcaagggaagtgattggctaggagatcaa
gatgccatccaatatatgtgtagggaagcaccaaaggcggtcattgagctagagaattat
ggattaccattttctcgaacagaggatggaaaaatatatcagcgtgcatttggtggtcaa
agcttaaactatggaaaaggtggtcaagcttaccgctgtgcatgtgctgctgatcgaact
gggcatgctttattgcacactctctatggccaagctatgagacacaatacccagtttttt
gtggaatattttgctttggatcttttaatgaatagtgatggaagttgccaaggagtaatt
gccttgaatatggaggatggaacgctccatcgtttccaagctgcttcaacgattttggcc
acagggggttatggtagagcatacttttctgcaacctcagcacatacatgtactggagat
ggcaatgccatggttgcacgtgctggcattcctctcgaggatttggagtttgtgcaattt
cacccaaccggtatatatggagcaggttgcctcatcacggaaggttctcgtggtgaaggt
ggaattcttagaaatagtgagggtgagcgatttatggaacgatatgcccctactgcaaag
gatcttgcatcaagggatgtagtttcaagatcaatgactatggagattcgggaaggtcgt
ggtgtagggcccctgaaagatcacatctacctccacttgaatcacttacccccagatgtg
ctcaaggagagacttcctggtatctctgaaactgctgctatttttgctggtgtggacgtt
acaaaggaacctattcctgttttgccaactgtacattataacatgggtggtattcccaca
aaccatcatggagaggtggttaccattaaaggtgacaatccagatgcagtggttcctgga
ttgatggctgctggggaaacagcctgtgcatcagtccatggcgccaataggcttggtgca
aattcacttctggatattgttgtttttggtagagcttgtgcaaatagagttgcagaagtc
cgtagaccaggagagaaacaaaagcctttagagaaggatgctggtcagaaaacaattgcg
tggctggacaaattgagaaattcaaatggttcgttgccaacctcaaaaattcggttgaat
atgcagcgagtgatgcaaagcaatgctgctgtattccgtacacaagagaccttagaagaa
ggttgtcaattaatcgataaaacgtgggagagcttccatgatgtcaagttggaggaccga
agtttgatatggaactccgacttgattgagactattgagttggaaaatcttttgataaat
gcatgcatcacaatgcactctgctgaagctaggaaagagagtagaggagctcatgcccgt
gaagactttaagactagagatgatgagaactggatgaaacacactgtgggattctgggag
aacgagaaggtcaggttggattacaggccagtgcatatgaatacattggatgatgaggtt
gaatcatttcctcccaaggctcgcgtgtattaa

DBGET integrated database retrieval system