KEGG   Cajanus cajan (pigeon pea): 109801129Help
Entry
109801129         CDS       T04868                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109801129
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccaj03036]
    109801129
Enzymes [BR:ccaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109801129
Chromosome and associated proteins [BR:ccaj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109801129
   Polycomb group proteins
    PRC2-EZH2 complex
     109801129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 109801129
NCBI-ProteinID: XP_020217717
LinkDB All DBs
Position
6
AA seq 861 aa AA seqDB search
MASKPSPSPSSSRSEPLVDPSATKVEVAGPMVKDVLLVIDSLKKQVAAERVVYVKNRIEE
NRQKLVGVTNHLCKMSMERRNCSITDTDRSLDLLTKRQKDAIDMHNGVHASNGDMESNGY
HEDNHGSTAVLLGSNVTVKNAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRI
YYDQNGGEALICSDSEEEIMEDEEEKREFIESEDYILRMTVKEFGLSDIVLESLGQCFSR
NTNEIKARYETLGVKDNAGGCSKVGDSEENSHSGNSFLEKDLEAALDSFDNLFCRRCLVF
DCRLHGCSQDLVFPAEKQPTWIPPDTENAPCGLNCFRLVLKSERFAKTSSAQADGEEKGS
GGTLSSRKKPSAKRRLKNSQSESASSNAKNISESSDSENGPGRDAVTASQSAPPKTKPVG
KGGIGKRNSKRVAERVLVCMQKRQKKTMVSDSDSISEAVDHSSNDMVTDPHAMSSEDNTR
KEEFVDDNVCKQEIVDNKSWKALEKGLLEKGMEIFGRNSCLIARNLLNGLKTCWDVFQYI
NCEEGKMSGPPGDAANCLLEGYSKGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIRKR
ITERKDQPCRQYNPCGCQSACGKQCPCLQNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRS
RQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLLGRSD
VSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRK
GDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPAWARKP
EASGSKKEDGAPSSGRAKKLA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaagccgtccccttcgccctcttcttccagatcggagcctctcgtcgatccc
tccgcaacaaaagtggaggttgcaggtccgatggttaaagacgtgttactggttattgat
tctttgaagaaacaagttgctgcggaacgtgttgtttatgttaagaatagaatagaggaa
aacagacagaagctggttggagtcacaaaccatctctgcaaaatgtcaatggagagaagg
aactgcagcattactgatacggatagaagtctggacctattgacaaagaggcaaaaagat
gcaatagatatgcacaatggtgttcatgcaagtaatggtgatatggagagcaatggctat
catgaagataaccatggttctacagcagttcttctagggtctaatgttactgtaaagaat
gctgttcgacctatcaagttacctgaagtaaaaagattgcctccttacactacgtggatt
tttctggacagaaatcaaagaatgactgaggatcagtcagttgtaggccggagacgaatt
tattatgatcaaaatggtggcgaagcacttatttgcagtgacagtgaggaggaaattatg
gaggatgaagaggagaaaagagaatttatagaatcagaagattatatacttcgcatgact
gtcaaagaatttggtttatctgacattgttctggagtcgttgggtcagtgtttttctaga
aacactaatgaaattaaggcaaggtatgaaactcttggtgttaaagacaatgctggtggg
tgttccaaggttggagattctgaagagaattcccacagtggcaattcttttctagaaaag
gatcttgaagcagctcttgactcttttgacaaccttttttgtcgacgatgtcttgttttt
gattgtagattacatggatgttcacaggatcttgtcttccctgctgagaagcaacctact
tggatccctcctgatactgaaaatgcaccatgtgggctaaattgtttccgattggtgctt
aagtccgaaaggtttgccaaaacatcctctgcccaggctgatggtgaagagaaaggctct
ggtggtactttatctagtaggaaaaagccttcagctaaaaggcggttaaaaaatagccaa
agtgaaagtgcttcatctaatgcaaagaacatatctgagagtagtgactcagagaatggt
cctggacgtgatgctgttacagcctcccaatcagcacctcctaaaactaaacctgtgggg
aaaggtggaattggtaagagaaatagtaagcgagtggcagaacgagtcctggtttgcatg
cagaaacggcagaagaaaacaatggtttctgattctgattccattagtgaagctgttgat
cattcatcaaatgatatggtcactgacccacatgcaatgagcagtgaagacaacacaagg
aaagaagagtttgtggatgacaatgtttgtaaacaagaaatagtggataataaatcttgg
aaagctcttgaaaaggggcttttagagaaaggaatggagatttttggtagaaacagttgc
ttaatagctaggaatctcttaaatggtttaaagacatgctgggatgttttccaatacata
aattgtgaagaaggaaagatgtctggtcctcctggggatgctgcaaattgtctcttggaa
ggctattctaagggtaataacgaagtgagacgaaggtctagatttttacgtagaagagga
agagtccgtcgattgaagtacacctggaaatctgctgcttaccattcaattaggaaaagg
attacagagagaaaggatcaaccctgtcggcagtataatccatgtggctgccaatcagct
tgtggaaagcagtgtccttgccttcaaaatggaacctgctgtgagaagtactgtggatgc
cccaagagctgcaagaatcgatttcgtggctgtcattgtgctaagagtcaatgccgaagt
cgtcaatgtccatgctttgctgcagatagggaatgtgatccagatgtttgtaggaattgt
tgggtcagttgtggtgatggtactcttgggattcctagccaaagaggggacaattatgaa
tgtagaaacatgaagcttcttctcaaacagcagcaaagggttcttcttggaaggtcggat
gtatcaggctggggagccttcttaaagaatagtgttggtaaacatgaataccttggagag
tatactggagagttgatttcacatcgggaagcagataagcgaggaaagatatatgaccgt
gaaaattcatcttttctctttaatttgaacgaccagtttgttcttgatgcttatcgaaag
ggtgataaattgaagtttgcgaaccattctcctgatccaaattgctatgcaaaggttatt
atggttgctggagatcatagggtaggcatttttgcgaaggagcggatttgtgccggggag
gaactgttctatgattatcgttacgagcccgacagggcccctgcctgggctcggaagcca
gaggcgtctggatcaaaaaaagaggacggggctccttcaagtggtcgtgcaaagaagctt
gcttaa

DBGET integrated database retrieval system