KEGG   Cajanus cajan (pigeon pea): 109802892Help
Entry
109802892         CDS       T04868                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj03030  DNA replication
ccaj03410  Base excision repair
ccaj03420  Nucleotide excision repair
ccaj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109802892
   03410 Base excision repair
    109802892
   03420 Nucleotide excision repair
    109802892
   03430 Mismatch repair
    109802892
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ccaj03032]
    109802892
   03400 DNA repair and recombination proteins [BR:ccaj03400]
    109802892
Enzymes [BR:ccaj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109802892
    6.5.1.6  DNA ligase (ATP or NAD+)
     109802892
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109802892
DNA replication proteins [BR:ccaj03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109802892
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109802892
DNA repair and recombination proteins [BR:ccaj03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109802892
   NER (nucleotide excision repair)
    Other NER factors
     109802892
   MMR (mismatch excision repair)
    Other MMR factors
     109802892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL
Motif
Other DBs
NCBI-GeneID: 109802892
NCBI-ProteinID: XP_020219891
LinkDB All DBs
Position
7
AA seq 1380 aa AA seqDB search
MDSQTLDSTDLFLAALKTLELSPPPSPSLPPIPPSVPHSKLIPHTRFLVDAFRHAGPHSH
SYFLSHFHSDHYAPLSPSWSRGPIFCSHKGRTNXKVKNLHTDSPLLIDGVHVTLIDANHC
PGAVIFLFSIPRPPAAPLRYVHTGDFRFSNTLISEPALAPFVGADAVFLDTTYCNPKFKF
PSQEESVEYVLNVVENVERECEGSSDNVLFLVATYVIGKEKILLELARRFKRKIHVDARK
MEVLSVLGYGESGEFTEDGKESNIHVVGWNVLGETWPYFRPNFVRMKELMAERRGSYSRV
VGFVPTGWTYEVKRGRFAVKSKDSFQIHLVPYSEHSNYDELREFVKFLKPKRVVPTVGLD
VEKSDSKHADKMRKYFAGLVDETANKQEFLRGFCQAPGDVGFEVEKGVDAKKEVKQSETE
GGGSINPDVAVSLSTSMREACTQDPALLNDEEKEKIIQELSCCLPSWVTRNQLLDLIGIS
GTNVVEAVSNFYERETEFHEQVNSCKAPVSTSKCCTLNDTDSLKKPCPNTNDASKNINIF
PSQDTTKITNLKRTVPSPISPAKRKRSNESKQNKIVKTKAKAKSEPSGAKQPTITRFFSK
VMPEAPGSTQTDSIGPKLEQSSKVVDLLPTHEEQQYKDEIDQFMQIINGNKSLKEYAITI
IEKTKGDVNKALDIYYCNANNLGEGEISCQVESKIDRPVVKKHASEELRIIPDISEQKVL
KDNVDAAHLSLPPDKYNPKEHACWRDGQPAPYLHIARTFNLLEGEKGKIKATSLLCNMFR
SLLILSPADVLPAVYLCTNKIAADHENKELNIGGSLVTAALEEACGTNRLKIREMYNKFG
DLGDVAQECRQTQRLLASPTPLLIKDVFSALQNISVQTGSGSTSRKKGIIVHLMRSCREK
EMKFLVRTLVRNLRIGAMLRTVLPALAHAVAMNSCPTLHKKGTAENLKEKLQVLSMEVVE
AYNILPNLDLIVPSLMNKGIEFSVSNLSMVPGIPIKPMLAKVTNGIPQALKLFENKAFTC
EYKYDGQRAQIHRLVDGSIRVFSRKGDESTSRFPDLIDIIKESSKPVASTFIMDAEIVGI
DRKNGYRIMSFQELSSRERGGRDMLITAESIKVDICIFVFDIMFANGEQLLGFPLRLRRK
YLRDLFYDEKPGYFEYAKETTIEADNACLTCEATLTKINAFLEDALRSSCEGIMVKTLDV
DAGYFPSKRSDKWLKVKRDYVEGLNDTLDLVPIGAWHGNGRKAGWYSPFLMACFNPETEE
YQSVCRVMSGFSDSFYIEMKEFFSGDKVLSKKPPYYQTGEAPDMWFSPQVVWEIRGADFT
VSPVHHAAIGLVHPSRGISIRFPRFIRSVSDRNPEECSTPADIVEMFHSQTRKMDVTAQN
NT seq 4143 nt NT seq  +upstreamnt  +downstreamnt
atggattcccaaaccctagactccaccgatctcttcctggccgccctcaaaaccctggaa
ctctctccgccaccctcaccctccctccctccaatccccccctccgtcccccactccaag
ctcattccccacacccgcttcctcgtcgacgccttccgccacgccggtccccactcccac
tcctacttcctctcccacttccactccgaccactacgccccactctccccctcctggtcc
cgcggccccatcttctgctcacacaagggaaggactaattgaaaggtgaagaatttacat
actgattcccccctcctcatcgacggcgtccacgtcaccctcatcgacgccaaccactgc
cccggcgccgtcatcttcctcttctccatcccccgcccccccgccgcccccctcaggtac
gtccacaccggcgacttccgcttttctaataccctcatttcggagcccgccctcgctccc
ttcgtcggcgccgacgccgtgtttctcgacaccacatattgtaaccctaaatttaaattc
ccctcgcaagaggagtctgttgagtatgttctcaatgttgtggaaaacgttgagcgtgag
tgtgagggtagtagtgacaacgttttgtttcttgttgctacttatgttattggaaaggag
aagattttgcttgagcttgcacgcaggtttaagaggaagatacacgtggatgctagaaag
atggaggttttgagcgttcttggatacggggagagtggcgagtttaccgaggatgggaag
gagagtaatattcatgtggttgggtggaatgtgttgggggagacttggccatactttagg
cctaattttgttagaatgaaggagcttatggctgagagaagagggtcctactccagggtt
gtggggtttgttccgactgggtggacttatgaagtgaagaggggtcggtttgcggttaag
tccaaggattcgtttcagattcatcttgtgccgtatagcgagcactcgaactatgatgag
cttagggagtttgtcaagtttttgaagcccaagcgggttgttccaacggtggggttggat
gttgagaagagtgacagcaaacatgctgacaaaatgaggaagtattttgctgggttggtt
gatgagactgccaataagcaggagtttttaagggggttttgtcaagctcctggtgatgtg
ggttttgaggttgagaagggtgttgatgcaaagaaagaagtcaaacaatcagagacagaa
ggtggtggaagtattaatccagatgtggctgtgagtttgtccacttctatgagagaagct
tgtacacaagatcctgctttgctgaatgatgaagaaaaagagaaaatcattcaagaactg
agttgttgtttgccctcatgggtcacccgaaaccagctgttagatctgattggcatctca
gggaccaatgttgttgaagctgtttctaatttctatgaacgtgaaactgaatttcatgag
caagtgaattcctgtaaagctcctgtttcaacatccaagtgctgcacattaaatgacacg
gattcacttaaaaaaccttgccctaatacaaacgacgcttccaaaaatattaacattttt
ccaagtcaagacacgactaaaataactaacctgaagcgtacagtaccaagtcccatttct
cctgccaaaaggaagagaagtaatgaaagtaagcaaaacaaaatagtcaaaacaaaagcc
aaagcaaaatctgaaccaagtggtgcaaagcagccgacaattacaagattcttcagtaaa
gtgatgcctgaagcgcctggcagtactcaaactgatagtattggaccaaagcttgagcaa
agttccaaagttgtagacttattgccgactcatgaagaacaacagtacaaggatgagatt
gatcaattcatgcaaataataaatgggaacaagtcactaaaagaatatgccatcactata
attgagaagacgaaaggagatgtcaataaggcattggacatatattactgtaatgctaat
aatcttggtgaaggtgaaatatcatgtcaagtggagagcaaaattgatagacctgtagtg
aagaagcatgcatcagaggaattgagaattatacctgatatatctgagcagaaagtgtta
aaagataatgtagatgctgctcatctatctctaccacctgataaatacaaccctaaagaa
catgcatgttggcgtgatggacagcctgcaccatatctacatattgcacgaaccttcaac
cttcttgagggtgagaaaggaaagataaaagctacttcattgttatgcaatatgttcaga
agtttgttgatcttgtctccagctgatgtgcttcctgctgtgtatctatgcacaaacaaa
attgctgcagaccatgaaaataaggaactaaatattggtggaagtttagtcactgcagca
cttgaagaggcatgtggaacaaatcgattgaaaataagggagatgtataacaaatttggt
gatcttggtgatgttgctcaggagtgtcgtcaaacacagagattgcttgcatcacctaca
ccacttctaattaaggatgttttctctgcactacaaaatataagtgtacaaacaggcagt
ggaagcacgtctcggaagaaaggcatcattgttcatctcatgcgttcctgccgtgagaag
gagatgaagtttcttgttcggaccttggtcaggaacctaaggattggggcaatgcttaga
actgtgttgcctgcattggctcatgctgttgctatgaattcttgccctactttgcacaaa
aaaggaactgcagaaaatttgaaggagaaacttcaggttctttctatggaagttgttgaa
gcatataacatactgccaaatttggatctcatagttccatctctcatgaacaaaggcatc
gaattttcagtttcaaatttatcaatggttccaggaatccctattaagcctatgctagca
aaggtcaccaatggtattccccaagcattgaagctatttgaaaataaagcatttacatgc
gaatataagtatgatggtcagcgagctcaaattcacagattagttgatggttcaattcgt
gttttttcaagaaaaggggatgaatcaacttcaagatttcctgatctaattgacataatt
aaggaatccagcaagcctgttgcatcaactttcataatggatgcagaaattgttggtatt
gacagaaaaaatggatataggattatgtctttccaggagctatcttcacgtgaaagaggt
ggcagagatatgttgattactgcagagagcatcaaggtagatatttgcatctttgtcttt
gatatcatgttcgcaaatggagagcagttattgggttttcctctccgccttagacgaaag
tatctgagggatttgttctatgatgaaaaacctgggtattttgaatatgctaaggaaaca
actattgaagcagacaatgcttgtttaacctgtgaagcaacattaactaagataaatgct
tttctagaagatgcactacgctcttcatgtgaaggaattatggtgaaaacattggatgtt
gatgctgggtattttccatcaaagcgttctgacaaatggttaaaggtcaagagagattat
gtggaaggattaaatgatactcttgatttagtaccgattggtgcatggcatggaaatgga
aggaaagctggatggtatagtccatttcttatggcttgtttcaatcctgaaactgaggag
tatcaaagtgtatgtcgtgtgatgtctggattctcagattcattttacatagagatgaaa
gaatttttctctggggacaaagttttgtccaaaaagccaccatattatcaaacaggagag
gcaccagacatgtggttttctccacaagtcgtttgggaaataagaggagcagactttaca
gtatcccccgttcatcatgctgccattggtttagttcatccatctcgtggcatctcaatc
agatttccaagatttattcgttctgtctcagatagaaacccagaagaatgtagcacacct
gccgatatagttgaaatgtttcattctcagactcgaaagatggacgtcacagctcaaaac
tga

DBGET integrated database retrieval system