KEGG   Cajanus cajan (pigeon pea): 109802926Help
Entry
109802926         CDS       T04868                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00562  Inositol phosphate metabolism
ccaj01100  Metabolic pathways
ccaj04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109802926
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109802926
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccaj01009]
    109802926
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109802926
    3.1.3.48  protein-tyrosine-phosphatase
     109802926
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109802926
Protein phosphatases and associated proteins [BR:ccaj01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109802926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 109802926
NCBI-ProteinID: XP_020219930
LinkDB All DBs
Position
7
AA seq 417 aa AA seqDB search
MGLKYTKQGTPKLESSSIHHQMINYLTKNFIRNLVSKQRRRMLIAGYDLDMSYITDRVLA
MSFPAQRMRAVYRNPLWQVKSVLDMRHNEHYKIYNLCIEENYDPALFYGRVEAYPFDDNH
VPSLEMIKDFCESVESWLASDPKNIAVIHCMAGKGRTGLMVCAYLTYCGMSAEEALQLYA
DRRTTNNEGVSIPSQRRYVTYWESLLSNSVPRGTGNGPRDVNLPQPCSRELRRIRLYDTV
NIDSIFFVISELHEIPNEVYRPPVEAYRGYCRQVKKGYQRNNSPRYYISILEGDNDGMQS
ETEEPRIVVQMDTESPAIYQKSCLDHYFDKPIQVTGDVRVIFYEKMIGGRLFYCCFNTAF
IRNSLLQLTIQELDKVGNKGKSICGPDFCLELLFGPANAGYSSSSISNDEHSSDDSL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggggttgaaatatacaaagcagggaacaccaaaacttgagagctcgagcatacatcat
caaatgatcaattaccttaccaagaattttattcgtaacttggtatccaagcaacgtaga
agaatgcttatagctggttatgatcttgacatgtcatatatcacagatcgagtattagca
atgtcatttcctgcacaacgtatgcgagcagtgtatcgaaatcctctatggcaggtcaag
tctgtgttggacatgagacataatgaacattataagatctataatctctgtatagaagaa
aattatgatccagctctcttctatggacgcgtggaagcatacccctttgatgataaccat
gttccatctcttgaaatgatcaaagatttctgtgaaagtgtggagtcatggctggcaagt
gacccaaaaaacattgctgttatccattgcatggcaggaaaaggtagaactggattaatg
gtatgtgcctacctaacttattgcggcatgtcagcagaagaggctcttcaattgtatgca
gatagacgaacaaccaataatgaaggagtatcaataccaagccaacgtcgttatgtgaca
tactgggaaagtctactttctaattctgtccctaggggaactggaaatggaccacgagat
gtgaacttgcctcaaccatgtagcagagaattgcggcgaatccggctatatgatacagtc
aacatagactcaatattctttgttatctcagagctacacgagattcctaatgaggtgtat
cgtccaccagtggaagcttaccgtggctactgtagacaggttaagaaaggatatcagaga
aacaacagccctcgctattatatttcaattcttgaaggtgataacgatggaatgcaatca
gaaacggaagaacctcgcattgtcgttcagatggacacagagtctcctgcaatataccaa
aaatcatgtttggaccattattttgataaacctatacaagtaactggagatgtacgtgtc
atattctacgagaaaatgataggaggtcgccttttctactgctgtttcaatacagctttt
attaggaacagcttactacagctcacaatacaagagttggacaaagttggtaacaaggga
aaatcaatatgtggccctgacttctgcctagagttgttgtttggtcctgctaatgcagga
tattcatcgtcaagtatatccaatgatgaacattctagtgatgattccttataa

DBGET integrated database retrieval system