KEGG   Cajanus cajan (pigeon pea): 109803240Help
Entry
109803240         CDS       T04868                                 

Definition
(RefSeq) methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial-like isoform X1
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00410  beta-Alanine metabolism
ccaj00562  Inositol phosphate metabolism
ccaj00640  Propanoate metabolism
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109803240
   00562 Inositol phosphate metabolism
    109803240
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109803240
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109803240
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     109803240
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     109803240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh FAR1
Motif
Other DBs
NCBI-GeneID: 109803240
NCBI-ProteinID: XP_020220309
LinkDB All DBs
Position
8
AA seq 724 aa AA seqDB search
MMDAQSSTELDETAQMLPPPPGTFVDREELIQHVGDFAVSQGYVVTIKQSKRDKVVILGC
DRGGVYRNRRKPSEESSTEHSRKRKTGSRLTNCPFEAVGKKDDGLWVLTIKNGTHNHEPL
KDMSEHPSARRFTEGEVLLIKEMTDAGLKPRQILKRLRQNNPELLSTPKHVYNVKAKLRQ
GNTNVRNFKSLRHEKSAVRNNYLAVIEPLWRQCNPPRVTNLIGGRFVDSQSCASIDILNP
ASQQVVSQVPMTTNEEFKAAVFSAKRAFSLWRNTPVTTRQRIMFKFQELVHRDIDKVAMN
ICTEHGKTLQDAHYDVLRGLEVVEHACGVGNLIKGDFVPNVSDGIDTYSIREPLGICAGI
CSFDFPAMIPLWMFPIAVTCGNTFILKPSEKNPVIMSGASVMLAELAIEAGLPNGVLNIV
HGTNDIVNAICDDDDIKAVSFVGSNTVGAYVYTRASTKVVEVNVNWLVGYCLQSNIGTKN
HAVIMPDARVDATLKALVTAGFGAAGQKCTALSAVVFVGNFSQWEDKLVEHAKKLKVNAG
TEPDADLGPVISQQAKEHTCRLIQTGVESGAKLVLDGRNIVVPGYEQGNFIGPTILSDVT
VDMECYKEEILGPVLLCMEVNSIHEAINIINSNEYGNGASIFTTSSAAATRFQTEVEVGQ
VGINVPISVSLPFSSFISSRPSFVGDLNFDGRAGIQFYTQIKRVAKQWSDTLDGDKAILE
IPFT
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgctcaaagcagcacagaattggatgaaactgcacaaatgcttccacctccc
ccaggcacatttgtagatcgggaagaactcatccaacatgttggagactttgctgtgtcc
caggggtatgtggtgactatcaagcaatccaagagggataaagtagttatactaggctgt
gacagaggaggtgtctatcggaaccggcgaaaaccttctgaagagtcctcaacagaacat
agtcgtaaaagaaaaactggttctcgtctaacaaattgtccttttgaagctgtgggcaag
aaggatgatggtttgtgggtactcaccataaaaaatggaacacacaatcatgagccctta
aaggacatgtcagaacatccttctgcccgtcgcttcacagagggagaagttttgctcatt
aaagaaatgacagatgctgggttgaaacctcgacaaattctaaagcggctgagacaaaac
aatccagaacttttatcaacaccaaagcatgtttataatgttaaagctaagcttagacaa
ggaaacacgaatgttaggaatttcaagtcattgagacatgagaagtctgccgtaagaaac
aactatcttgctgtaattgaaccattgtggcggcagtgcaaccctccaagggttaccaat
cttattggaggaagatttgttgattcacagtcatgtgcatcaattgacattttaaaccct
gcaagccagcaagttgtttctcaagttccaatgactacaaatgaggagttcaaagcagca
gtgttttctgcaaaacgggccttctcattgtggcgtaacacaccagttaccactcgtcaa
agaatcatgtttaagttccaagagcttgttcatagagacattgataaggttgctatgaat
atttgtactgaacatggaaaaacactgcaagatgcacattatgatgtgttacgtgggcta
gaggttgttgaacacgcttgtggtgtaggaaatttgataaagggggattttgtacctaat
gtgtccgatggaattgacacatacagcattagagagccacttggtatttgtgctggtatc
tgctcttttgattttccggctatgattccattatggatgtttcctattgctgtcacatgt
ggcaatacatttattctaaagccatcagagaagaatccagttataatgtcaggggcatct
gtgatgctggcagagttagcaattgaggctggtttacctaatggtgtgttaaatattgtt
catggtacaaatgacattgtcaatgctatttgtgacgatgatgatataaaggctgtttcc
tttgttggttcaaatacagttggtgcttatgtatacacaagagcatctaccaaagtagtt
gaggtcaatgtaaattggctggttggctattgtcttcagtccaatattggaaccaaaaat
catgccgtcataatgcctgatgcaagagtagatgctactttgaaagctttggttacagct
ggttttggtgcagctggacagaagtgcacagcactaagtgctgttgtttttgttggaaat
ttcagtcaatgggaagataaactagtagagcatgcgaaaaaacttaaggtcaatgctgga
acagagccagatgcagaccttggtcctgtaattagccaacaggcaaaggaacacacttgc
agattgattcaaacaggtgtggaatctggggctaaactagtgcttgatggaagaaatatt
gtggttccaggttatgaacagggaaacttcattggtcctaccatcttgtcagatgtcaca
gttgatatggaatgctacaaggaggagattcttggcccagttcttctgtgtatggaggtt
aacagcatacatgaggcgataaacatcatcaatagcaacgaatatggtaatggagcatcc
atctttacaacttctagtgcagcggcaacaagattccagactgaggttgaagttggacag
gttggcataaatgtcccgatctctgtttcattgcctttttcttcattcattagctccagg
ccatcttttgttggtgatttgaattttgatgggagagctggaattcagttttacacacag
attaagagggtcgctaaacaatggtctgacacattagatggagataaagcaattcttgaa
ataccttttacttag

KEGG   Cajanus cajan (pigeon pea): 109803242Help
Entry
109803242         CDS       T04868                                 

Definition
(RefSeq) methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial-like isoform X1
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00410  beta-Alanine metabolism
ccaj00562  Inositol phosphate metabolism
ccaj00640  Propanoate metabolism
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109803242
   00562 Inositol phosphate metabolism
    109803242
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109803242
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109803242
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     109803242
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     109803242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF5482
Motif
Other DBs
NCBI-GeneID: 109803242
NCBI-ProteinID: XP_020220317
LinkDB All DBs
Position
8
AA seq 394 aa AA seqDB search
MATSHLTSQHRPSRIPNLIGGSFVDSKSLTFIDVINPATQEVVSQVPCTTDEEFKAAVSS
AKKAFTSWRNTPITKRQRVMLKFQELIRRDMDKLALNVTTEQGKTLRDAQGDVFRGLEVV
EHACGMATLQMGEYVSNVSVGIDTYSIREPLGVCAGICPFNFPAMIPLWMFPVAITCGNT
FILKPSEKVPGASVMLAELAMEAGLPEGVLNVVHGTHDIVNAICDDDDIKAISFVGSNVA
GMHIYARAAAKGKRVQANMGAKNHAVVMPDASVDATVNALVAAGFGAAGQRCMALSTIVF
VGGSKLWESKLVERAKALKVNAGTEPDADLGPVISKQAKERIHRLIQSGVESGARLVLDG
RNIVVPGYVSGNFIGPTILSDVTANMECYKVFYH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttctcatttaacaagccaacatagaccctcaaggattccaaatcttattggg
ggcagttttgtggactcaaaatctttgactttcattgatgttatcaaccctgcaacacaa
gaagtagtttcacaagttccttgcactacagatgaagagtttaaagctgcagtatcttca
gcaaagaaggcatttacatcatggagaaacactccaatcacgaaacgccagcgtgttatg
ttgaagttccaagagcttatacgcagagatatggataaacttgcattgaatgtgactact
gaacaaggaaagacgttaagggatgcacaaggagatgtgtttcgtggtttagaggtggtg
gaacatgcttgtgggatggcaactcttcaaatgggggaatatgtttccaatgtatcagtt
ggaattgatacttacagcattagagaaccacttggtgtttgtgctggtatttgtcccttc
aactttcctgcaatgattcccttgtggatgttcccagtggcaattacctgcggaaatacc
tttattctaaaaccgtcagaaaaagttccaggtgcttctgtaatgctagcagaattggca
atggaggctggtttgcctgagggtgtcttaaatgtagttcatggaacccatgatattgtg
aatgctatttgtgatgatgacgacatcaaagccatatctttcgttggttcaaatgttgct
ggaatgcacatatatgcgagagcagcagctaaagggaaacgtgttcaggctaatatgggg
gcaaaaaatcatgcggttgtaatgcctgatgcgagtgttgatgctacagtaaatgcttta
gttgctgcaggttttggtgctgctggacaaaggtgcatggctctcagcacgattgttttt
gttggaggctcaaaactgtgggaaagtaaacttgtggagcgtgccaaagctcttaaagta
aatgccggaactgaaccagatgcagacctcggtccagtcattagcaaacaagcaaaggag
agaatacacagattaattcaatctggggttgaaagtggtgcaagactggtgctcgatgga
agaaatatagtggtaccaggatatgtatctggcaattttattggtccaaccatcttatca
gatgtcactgccaacatggagtgctacaaggtattttatcactaa

KEGG   Cajanus cajan (pigeon pea): 109805205Help
Entry
109805205         CDS       T04868                                 

Definition
(RefSeq) methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00410  beta-Alanine metabolism
ccaj00562  Inositol phosphate metabolism
ccaj00640  Propanoate metabolism
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109805205
   00562 Inositol phosphate metabolism
    109805205
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109805205
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109805205
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     109805205
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     109805205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109805205
NCBI-ProteinID: XP_020222805
LinkDB All DBs
Position
9
AA seq 538 aa AA seqDB search
MLRLSIQRARKLNSLRCQIYALGSSHFSTAAEPSFSKRNPPRVPNLIGGSFLDSKSSTFI
DVINPATQEVVSQVPLSTNGEFKEAVLAAKKAFPLWRNTPITTRQRVMLKLQELIRRDMD
KLALNVTTEQGKTLKDAQGDVFRGLEVVEHACGMATLQMGEFVSNVSHGIDTYSIREPLG
VCAGICPFNFPAMIPLWMFPVAVTCGNTFVLKPSEKDPGASVLLAELALEAGLPEGVLNI
VHGTHDIVNAICDDDDIKAISFVGSNTAGMHIYSRAAAKGKRVQSNMGAKNHAIVMPDAN
VDATLNALVAAGFGAAGQRCMALSTVIFVGGSQQWEAKLIERAKALKVNAGTEPNTDLGP
VISKQAKERIHRLVQSGVESGAKLLLDGRNIVVPGYESGNFIGPTILSDITANMECYQEE
IFGPVLLSMQADSLEEAINIINNNKYGNGAAIFTTSGVAARKFQTEVEAGQVGINVPIPV
PLPFFSFTGNKGSFAGDLNFYGKAGVNFFTQIKTITQQWKDSTGSSKINLAMPTSQKY
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttgcggctttcgattcaacgagcgaggaagttgaactccctgaggtgtcagatctat
gctctgggaagttcccatttttcaacagctgctgaaccatcttttagcaagcgcaaccct
ccgagagttccaaatcttattgggggcagttttcttgactcaaaatcgtcaactttcatt
gatgttataaacccagcaacccaagaagttgtttcacaagttcctttgtctacgaatgga
gagtttaaggaagctgtattggcagcaaagaaggcatttccactgtggcgtaacacacca
attacaacacgccaacgggttatgttgaagctccaagagcttattcgcagagatatggat
aaacttgctctgaatgtgaccactgaacaaggaaagacattaaaggatgcacaaggagat
gtgtttcgtggtttagaggtggtagaacatgcttgtggaatggcaactctgcaaatgggg
gagtttgtttccaatgtatcacatggaattgatacttatagcattagagaaccacttggt
gtttgtgctggtatttgtcctttcaactttcctgcaatgattcccttgtggatgttccct
gtcgctgttacctgtggtaatacctttgttctaaaaccatccgagaaagacccaggtgct
tctgtactgcttgcagaattggcattggaggctgggttgcctgagggtgtcttaaatata
gttcacggaacccatgatattgtgaatgctatttgtgatgatgacgacattaaagccata
tcctttgttggttcaaatactgccggaatgcacatatattcaagagcagcagctaaaggg
aaaagagttcagtctaacatgggggccaaaaatcatgcaattgtcatgccagatgcaaat
gttgatgctactttaaatgctttagtcgctgctggttttggtgctgctggacaaaggtgt
atggctctcagcacagttatttttgttggtggctcacaacaatgggaagctaaacttatt
gagcgtgccaaagctcttaaagtaaacgctggaactgaacccaatacagaccttggtccg
gtgattagcaaacaggcaaaggagcgaattcacagattagttcaatctggggttgaaagt
ggtgccaaactactgcttgatggaagaaatatagtggtcccgggatatgaatctggcaat
tttattggcccaaccatcttatcagatatcactgccaacatggagtgctaccaggaggaa
atttttggcccagttcttctttcgatgcaggctgacagcttggaagaggccataaacatt
atcaacaataacaagtacggaaatggtgctgctatatttactacatctggtgttgctgca
aggaaatttcagaccgaggttgaggctgggcaggttggcatcaatgttcccattccagtt
cctttgcccttcttctcattcacaggcaacaagggatcgtttgccggtgatctcaacttt
tatggcaaggcaggggttaacttctttacacagatcaagacaataacacagcagtggaag
gattcaactggcagtagcaagattaacctggcaatgccaacctctcaaaaatattga

DBGET integrated database retrieval system