KEGG   Cajanus cajan (pigeon pea): 109805576Help
Entry
109805576         CDS       T04868                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00620  Pyruvate metabolism
ccaj00710  Carbon fixation in photosynthetic organisms
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Module
ccaj_M00168  CAM (Crassulacean acid metabolism), dark
ccaj_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ccaj_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ccaj_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    109805576
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109805576
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109805576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 109805576
NCBI-ProteinID: XP_020223305
LinkDB All DBs
Position
10
AA seq 967 aa AA seqDB search
MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV
YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK
LKKGDFADENNATTESDIEETLKRLVVDLKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHGRVRNCLTQLYAKDITPDDKQELDEALQREVQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPTFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRADELNRSSKKDAVAKHYIEFWKT
IPPNEPYRVLLGEVRDRLYQTRERSRHLLAHGHSDIPEEETFTNVEEFLEPLELCYRSLC
ACGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLEIGSYQEWSEE
KRQQWLLSELSGKRPLFGPDLPQTEEIRDVLDTFHVIAELPADNFGAYIISMATAPSDVL
AVELLQRECHVKHPLRVVPLFEKLADLEAAPAALARLFSVDWYRNRINGKQEVMIGYSDS
GKDAGRFSAAWQLYKAQEELIKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEQHLCFRTLQRYTAATLEHGMHPPISPKPEWRALMDEMAVIA
TEEYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPAKRRPSGGIETLRAIPWIFAWTQT
RFHLPVWLGFGAAFKHVIEKDVRNIHMLQEMYNQWPFFRVTLDLVEMVFAKGDPGIAALY
DRLLVSKDLWPFAEQLRTKYEETKELLLQVAAHRDLLEGDPYLKQRLRLRDSYITTLNVC
QAYTLKRIRDPNYNVKLRPHISKESIEISKPADELITLNPTSEYAPGLEDTLILTMKGIA
AGLQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaggaacttagaaaagatggcttcaattgatgctcagcttcggctgttggtt
ccagccaaagtgagtgaggatgataaactggttgagtatgatgctttgctcttggatcgg
ttccttgatattcttcaggatttacatggagaggatctgaaggaaacggttcaagaggtg
tatgagctttctgctgaatatgaagggaagcatgacccaaagaaactggaggaacttgga
aatctgataactagtttggatgctggagattccattgttgttgccaagtccttttcccac
atgcttaacttggccaacttagctgaagaggtccaaattgctcaccgcagaaggaacaag
ttgaagaaaggagattttgctgatgagaacaatgccacaactgaatcagacattgaagaa
actctcaagagacttgtggtggatttgaagaagtctcctcaggaagtttttgatgcactg
aaaaaccagaccgttgatctggttcttactgctcatcctactcaatcagtccgaagatct
ttgcttcaaaagcatggaagggtaagaaattgtttaactcagttgtatgccaaagacatc
actcctgatgataagcaggaacttgatgaggctctacagagggaggtccaagctgcattt
cgtactgatgaaatcaggaggacccctccaaccccacaagatgagatgagagcagggatg
agctacttccatgaaacaatttggaagggtgtacccacatttctgcgtcgtgttgataca
gctttgaagaatatagggattaatgaacgtgtcccttataatgctcctctcattcaattt
tcttcttggatgggtggagatcgtgatggcaatccaagagttactcctgaagtgaccaga
gatgtttgcttattggctagaatgatggctgctaatttgtactattcccagatagaggat
cttatgtttgaactgtcaatgtggcgctgcaatgatgagctacgtgtccgtgcagatgaa
cttaacagatcttccaaaaaagatgcagttgcaaaacactacatagaattttggaaaacc
attcctccaaatgagccatatcgtgtgttactgggtgaggtaagggacaggctttaccag
actcgtgagcgctcgcgccatttgctagctcatggccactctgacattccagaggaagaa
actttcaccaatgttgaggagttcttggaaccacttgaactgtgttacagatcactctgt
gcttgtggcgatcgcgcaattgccgatggaagccttcttgatttcttgaggcaagtctcc
acttttggactctccctagtgaggcttgacataaggcaagagtcagaccgccacactgac
gtcttagatgccatcaccaagcatttggaaataggctcataccaggaatggtctgaggaa
aaacgacaacaatggcttttatctgagttgagtggcaaacgacccctatttggccctgac
cttccccaaacagaagaaatcagagacgttttggacacatttcatgtcatagcagaactt
ccagcagacaactttggagcatacatcatctcaatggcaactgcaccatctgatgtgcta
gcagttgagcttctgcagcgggaatgccatgtcaagcatcccttaagagttgttccattg
tttgagaagctagctgatctagaagcagcgccggcggcgctggcacggttgttctcagta
gactggtacagaaacaggatcaatgggaagcaggaagtgatgattggctactctgattca
ggaaaagatgccggaaggttttcggcagcgtggcagctgtataaggctcaggaggagctc
ataaaggtggctaaggagtatggtgtgaagctgacaatgttccatggtcgtggagggact
gttggaagaggaggtggtccaactcaccttgctattctgtctcagcctccagatacaatt
catggatcactgcgtgtgactgtgcaaggtgaagttattgagcaatcttttggagagcag
cacttatgtttcagaacgctgcaaaggtacactgctgctactctagaacatggaatgcac
cctccaatttctcctaaaccagaatggagggctttgatggatgagatggctgtcattgcc
actgaggagtaccggtccattgtgttcaaagaaccacgttttgttgagtatttccgcctg
gctacacctgagttggagtatggaaggatgaacatcggaagtagaccagcaaagaggaga
ccaagtggaggtattgagacactgcgtgctataccttggatctttgcatggacacaaaca
aggttccatcttccagtgtggctaggctttggtgcagcttttaaacatgttattgagaag
gatgttaggaacattcatatgctgcaagagatgtacaatcaatggcctttctttagggtc
actcttgatttagtggaaatggtgtttgccaaaggagacccagggatagctgctctgtat
gataggctccttgtttcaaaggatctgtggccatttgcggagcaattgaggaccaagtat
gaagaaactaaggaactcctccttcaggtggctgcccacagggatcttcttgaaggagat
ccatacctgaagcaaagactccgtttgcgtgattcatacatcacaaccctaaacgtgtgc
caagcttacaccttgaaaagaatccgtgatccaaactacaacgtgaagctgcgtcctcac
atctccaaagagtccatagagataagtaagcctgctgatgaactcataacactcaacccc
acaagtgaatacgcccctggcttggaagacaccctcattctcaccatgaagggtattgct
gctggcttgcaaaacactggctaa

DBGET integrated database retrieval system