KEGG   Cajanus cajan (pigeon pea): 109805759Help
Entry
109805759         CDS       T04868                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00052  Galactose metabolism
ccaj00511  Other glycan degradation
ccaj00531  Glycosaminoglycan degradation
ccaj00600  Sphingolipid metabolism
ccaj00604  Glycosphingolipid biosynthesis - ganglio series
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109805759
  Lipid metabolism
   00600 Sphingolipid metabolism
    109805759
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    109805759
   00604 Glycosphingolipid biosynthesis - ganglio series
    109805759
   00511 Other glycan degradation
    109805759
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     109805759
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109805759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 109805759
NCBI-ProteinID: XP_020223537
LinkDB All DBs
Position
10
AA seq 707 aa AA seqDB search
MRIELKKKKTNAPGSKLLSMAKKLNSKPTLFFILVSFMLLCAFLPVFAPLPSFNSHPHRR
SHRNTVERKFEIANDRFWKDGEPFQIIGGDLHYFRVHPEYWEDRLLKAKALGLNTIQTYV
PWNLHEPAPGKLVFEGFANIEAFLNLCHKLGLLVMIRPGPYVCTEWDWGGFPGWFYSMNP
TPKLRSSDPSFLQLVERWWGNLLPKFVPLLYDNGGPIIMVQIENEYGSYGDDKAYLHHLV
TLARGHLGHEVILYTTDGGSRENLEKGTIRGDAVFSAVDFSTGDDPWPIFKLQKEFNAPG
KSPPLSSEFYTGWLTHWGEKFAKTDADFTAAALEKILQKNGSAVLYMVHGGTNFGFYNGA
NTGVNEADYKADLTSYDYDAPIRESGDVDNSKFNAIRKVIARYSSVPLPSVPSNIEKARY
GPIHLQRKALLFDMLDLTNSTNVFESEAPMSMEYVGQFFGFTLYVTEYKAKGGGRILFIP
KLHDRAQVFISCPSDDSGARPTYVGIVERGLNNKLNLPDVKCHSNVNLFILVENMGRVNY
GPFMFDRKGILSSVYLDEEKVKGWKMFPIPLHNLNELSTYNPIKQAAYSAFSEISSSRKK
LIHKYENTSKEPAFYSGKFSIDKSSQVKDTFISFNNWGKGIVFVNDFNIGRYWPLRGPQC
NLYVPAPILKQGDNFLVILELESADPELVIHTVDEPDFTCGFSVHQL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgaattgaagaagaagaagaccaacgctccaggttccaaactgctatccatg
gccaagaagctaaactcgaaacccacacttttcttcatcttggtctctttcatgctttta
tgtgcctttctccctgttttcgctcctcttccttctttcaactctcaccctcaccgtcgt
tctcatcgcaatacagttgagagaaagtttgagatcgccaacgataggttctggaaagat
ggtgaaccttttcagatcattggtggcgacttgcattattttcgagtgcatccagagtac
tgggaagatagactgttaaaagccaaggctttgggcttgaacacaatccaaacatatgtt
ccttggaatctgcatgagccagcaccgggaaagcttgtttttgagggttttgctaacatt
gaagcattcctcaacctttgtcacaaacttggtctcctcgtgatgattcgacccggacca
tacgtatgtacagagtgggattggggcggtttcccaggttggttctattccatgaaccca
acccccaaactaagatcatctgatccttcttttcttcaactggttgaaagatggtggggt
aacctgcttccaaagtttgttcctctcctatatgataatggaggccctataataatggtt
cagatcgaaaacgagtatggttcttatggagatgacaaagcatatctccatcacctggtc
accctggctagaggtcatctcggtcatgaagttattttatacactacagatggaggctct
agggaaaatcttgagaaaggaactattcgtggggatgctgtcttttcagctgtcgacttc
tctactggtgatgatccttggcctatattcaagttacaaaaggagttcaatgccccagga
aaatcaccacctttgtcatccgaattttacactgggtggcttacacactggggagagaaa
tttgctaagactgatgctgattttacagctgctgcacttgaaaaaattttgcaaaaaaat
ggttcggcagtcctctatatggtgcatggtgggacaaactttggattttacaatggagca
aatactggtgtaaacgaggctgactacaaagctgatctcacttcatatgattatgatgca
ccaattagggaatctggtgatgttgacaattcaaaattcaatgctattcgaaaggttatt
gctcgatatagctcagtacctcttccatctgttccctctaatattgaaaaggcaagatac
ggaccaattcacttacaaagaaaagcgcttttattcgacatgttagatttaaccaattct
accaatgtgttcgaatccgaagctccaatgtcaatggagtatgtgggccagttttttggt
ttcacactatatgtcactgaatacaaagcaaagggaggtggaagaattttgtttatacca
aagttacatgacagagctcaagtatttatttcatgcccttctgatgacagtggtgcaagg
ccaacttatgttggaattgttgaaaggggtttaaataacaaactaaatcttcctgatgtt
aaatgtcattctaacgtcaacttatttattctggttgaaaacatgggtcgtgtaaattac
gggcctttcatgtttgataggaagggcattctgtcttctgtttatctggacgaggaaaaa
gtaaaagggtggaaaatgttccctattcctttgcacaacctgaatgaattatcaacctac
aatcccatcaagcaagctgcatattctgcgttcagtgaaatttcatcgtccagaaagaag
ttgattcataagtatgagaatacttcaaaagagcctgctttttattctggcaagttctca
attgataaatcaagtcaggtcaaggatacatttatatcattcaacaattggggaaaaggc
attgtgtttgttaatgacttcaatataggaagatattggccgttgagaggaccacaatgc
aacctctacgttcctgctccaatccttaagcaaggagataactttttggtaatactcgag
ttggaatcagcagaccctgaacttgtgatacacacagttgatgagccggacttcacatgt
ggttttagtgtccatcagctgtaa

DBGET integrated database retrieval system