KEGG   Cajanus cajan (pigeon pea): 109805841Help
Entry
109805841         CDS       T04868                                 

Definition
(RefSeq) glyoxylate/succinic semialdehyde reductase 2, chloroplastic
  KO
K18121  glyoxylate/succinic semialdehyde reductase [EC:1.1.1.79 1.1.1.-]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00630  Glyoxylate and dicarboxylate metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109805841
   00650 Butanoate metabolism
    109805841
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     109805841
    1.1.1.-  
     109805841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored ApbA 2-Hacid_dh_C Shikimate_DH Sacchrp_dh_NADP 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 109805841
NCBI-ProteinID: XP_020223670
LinkDB All DBs
Position
10
AA seq 334 aa AA seqDB search
MRCSTFCSHHLNLSAMIMKRFSAPISSHVSPRAQAITEPPARVGFLGIGIMGSPMAHNLL
KAGVDLTVWNRTKTKCDPLISLGAKYKPSPEEVAASCDVTFAMLADPQSAVDVACGKHGA
ANGIGPGKGYVDVSTVDGDTSKLISAQINSTGALFLEAPVSGSKKPAEDGQLIFLTAGDK
ALYETVGSLLDIMGKSKFYLGDVGNGAAMKLVVNMIMGSMMASFSEGLLLCEKVGLDPDV
LVKVVSQGAINAPMYSTKGPSMIQSLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAA
NELYKVAKSHGLSDQDFSAVIEALKSKIQHSENQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgttccacgttttgctctcaccacttgaacctttcagccatgattatgaagcgt
ttctctgctcccatttcatcccacgtttcgcctcgagctcaggctataactgagccacct
gcccgcgttggctttttgggcatcggaatcatgggctccccaatggcccataatctcctc
aaagctggagttgatctcactgtttggaataggaccaagaccaagtgtgatcctctaata
agcctgggagcaaaatataaaccatctcccgaggaagtagcagcatcttgcgatgtcacc
tttgccatgcttgctgatcctcaaagtgcagtggatgttgcttgtgggaaacatggggct
gcaaatggaataggtccagggaaaggctatgtggatgtttcaactgttgatggggacact
tctaaattgattagtgcgcaaataaactccactggagcattatttctggaggctccagtt
tcaggttccaaaaagccagcagaagatgggcagttgatatttcttacagcaggggacaaa
gctctttacgaaacagttggttctctcttggacatcatggggaaatctaaattttatctt
ggcgatgttggaaatggagcagcaatgaaacttgttgtcaatatgatcatgggcagtatg
atggcatccttttctgaaggcttacttctctgtgaaaaagttgggcttgatccagatgta
ctagtgaaggtagtttcacagggtgccattaatgctccaatgtactcaaccaaaggtcca
tccatgatacagtctctttatccaactgcattccccctgaagcatcagcagaaggatcta
agactagccctggggttagcagagtctgtttcccaatccactcctattgcagcagctgca
aatgagttatataaagttgcaaaatcccatggcctgagtgatcaggacttttcagctgtc
attgaagcattaaaatccaaaattcagcactcggaaaaccagtga

KEGG   Cajanus cajan (pigeon pea): 109808326Help
Entry
109808326         CDS       T04868                                 

Definition
(RefSeq) glyoxylate/succinic semialdehyde reductase 1-like
  KO
K18121  glyoxylate/succinic semialdehyde reductase [EC:1.1.1.79 1.1.1.-]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00630  Glyoxylate and dicarboxylate metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109808326
   00650 Butanoate metabolism
    109808326
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     109808326
    1.1.1.-  
     109808326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 ApbA F420_oxidored Shikimate_DH Sacchrp_dh_NADP 3HCDH_N NAD_Gly3P_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 109808326
NCBI-ProteinID: XP_020226865
LinkDB All DBs
Position
11
AA seq 290 aa AA seqDB search
MEVGFLGLGIMGKAMSINLLRHGFKVTVWNRTLSKCNELVEHGASVGETPAAVVKKCKYT
IAMLSDPSAALSVVFDKDGVLDHINGKCYIDMSTVDADTSSKISEAIKAKGGYFLEAPVS
GSKKPAEDGQLIILVAGDKALYDEVLPAFDVLGKKSFFLGEVGNGAKMKLVVNMIMGSMM
NAFSEGLTLAERSGLSPGTLLDVLDLGAMSNGMFKLKGPTMLKNSYPPAFPLKHQQKDMR
LALALGDENAVSMPVAAAANEAFKKARSMGLGDLDFSAVHETLKAPDHSS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggaggttggattcttgggtttgggtataatgggcaaggccatgtcaatcaatcttcta
cgccatggtttcaaagtcactgtgtggaacagaaccctctccaagtgtaatgaactcgtg
gaacatggtgcttcagttggagaaaccccagcagctgtagtcaagaaatgcaagtataca
attgcaatgttatctgatccttctgctgcattatcggttgtatttgataaagatggtgtt
cttgatcatattaatgggaaatgctatattgacatgtccacagttgatgctgatacatct
tccaagatatccgaggcaatcaaagcaaaaggtggttatttccttgaagctcctgtttcg
ggtagcaagaagcctgcagaagatggccaactaataatactcgttgctggggacaaggca
ttgtatgatgaagtactcccagcatttgatgtactggggaagaagtctttctttctgggt
gaggttggaaatggtgcaaaaatgaagcttgttgttaacatgataatgggaagtatgatg
aatgctttctccgagggactcacactagctgaaagaagtggtttgagccctggaactctt
cttgatgtgctggatctcggtgccatgagtaatggcatgtttaaattgaaaggacctaca
atgctcaaaaacagttatcccccagcttttccactgaaacaccagcagaaggacatgaga
ttagcacttgcccttggagatgaaaatgctgtatcaatgcccgtagcagctgcagcaaac
gaggctttcaagaaagccagaagcatggggttgggagaccttgatttttcagcagttcac
gagactttgaaagctcctgatcattcatcttga

DBGET integrated database retrieval system