KEGG   Cajanus cajan (pigeon pea): 109806524
Entry
109806524         CDS       T04868                                 

Definition
(RefSeq) cytochrome P450 86A1-like
  KO
K15401  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00073  Cutin, suberine and wax biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109806524
   00073 Cutin, suberine and wax biosynthesis
    109806524
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ccaj00199]
    109806524
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     109806524
Cytochrome P450 [BR:ccaj00199]
 Cytochrome P450, plant type
  CYP86 family
   109806524
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109806524
NCBI-ProteinID: XP_020224547
LinkDB
Position
10
AA seq 516 aa
MDTPVLLTLAATLLSAYFLWFLLLARTLSGPKAWPLLGSVPSMIVNRNQVHDFLAANLRN
TLGTYQTCILPFPLVARKEGFFTVTSNPRNIEHVLKTRFDNYPKGPHWQAAFHDLLGHGI
FNSDGDTWLMQRKTAALEFTTRTLRQAMARWVNRTIKNRLWCILDKAVKGKLSVDLQDLL
LRLTFDNICGLTFGKDPQTLSPDLPENTFTVAFDSATEITLQRLLYPGILWKFQKLLSIG
KERKMQQSLKIVETYMNEAISAREKSPSDDLLSRFMKKRDATGKPLSAAVLRQIALNFVL
AGRDTSSVALSWFFWLVMNHPAVEQKIIDELTAVLASTRGGDRRKWTEEALDFDEAEKLV
YLKAALTETLRLYPSVPQDFKHAVADDVLPDGTAVPAGSTVTYSIYAVARMKSVWGEDCM
EFKPERFLSVQGNRFEPPKDGYKFLAFNGGPRTCLGKDLAYLQMKSVAAAVLLRYRLLPV
PGHRVQQKMSLTLFMKHGLRVFLEPRQLEPQAATSA
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggacacacccgttctcttgaccctagcagctactctcctatcagcatatttcctttgg
ttcctcctcttggctcgaaccctatccggcccaaaagcatggccactgcttggcagcgtt
ccaagcatgatcgtgaaccgcaatcaggttcacgactttctggctgccaacctgcgcaac
acgctgggtacttaccagacctgcatcctcccttttcctctcgtcgcacgaaaggagggc
ttcttcaccgtcaccagcaaccctagaaacatcgaacacgtcctcaagacgcgcttcgat
aactaccccaaaggcccgcactggcaggccgcattccacgacctccttggccatggcatc
ttcaacagcgacggcgacacctggctcatgcagcggaaaaccgccgctctcgagttcacc
actagaaccctaagacaggccatggctaggtgggtcaaccggaccataaagaaccgctta
tggtgcattttggacaaagcggttaagggaaagctttcggtggatttgcaggaccttctt
ttgcgtttgacgtttgataacatatgtggactcacctttggtaaagaccctcaaactctc
tccccggatctacccgaaaacaccttcactgttgcgtttgactctgccacagaaatcacc
ttgcaaaggcttctgtaccctggcatactatggaagttccagaagcttctaagcattggc
aaggagagaaaaatgcagcaaagtttgaagatagtcgaaacttacatgaacgaagccatt
tcagctcgggagaagtctccctccgacgacttgctatcaaggttcatgaagaagcgcgac
gccaccggaaagccgctgagcgccgccgtactgcggcagattgcgctgaacttcgtcctc
gccggcagggacacctcctcggtggcgctctcatggttcttctggctcgtcatgaaccac
cccgccgtggagcagaaaatcatcgacgaactcaccgcggttctcgcctccacgcgcggc
ggagaccggcggaaatggacagaggaagcgttggacttcgacgaagccgagaagcttgtc
tacctgaaagccgcgctgacggagacgctgcgtctgtatccatcggtgccgcaagatttc
aagcacgcggtggcggacgacgtgcttccggacggcacggcggtgccggcgggttccacg
gtgacatattcgatctacgcggtggcgaggatgaagagcgtgtggggcgaggattgcatg
gagtttaaaccggagcggtttttatcagttcagggaaaccggttcgaaccgccgaaggac
ggttataaattcctcgcgtttaacggtggaccgaggacctgtttggggaaggacttggct
tatcttcagatgaagtctgtggccgctgccgtgcttcttcggtaccggctgttgccggtt
cccggtcaccgggttcagcagaagatgtcgctcacgctcttcatgaagcacgggctgcgc
gtgttcttggagccacgtcaactcgaaccgcaggctgccacgtcagcttga

DBGET integrated database retrieval system