KEGG   Cajanus cajan (pigeon pea): 109807367Help
Entry
109807367         CDS       T04868                                 

Definition
(RefSeq) acetate/butyrate--CoA ligase AAE7, peroxisomal-like
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00620  Pyruvate metabolism
ccaj00630  Glyoxylate and dicarboxylate metabolism
ccaj00650  Butanoate metabolism
ccaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109807367
   00630 Glyoxylate and dicarboxylate metabolism
    109807367
   00650 Butanoate metabolism
    109807367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 109807367
NCBI-ProteinID: XP_020225474
LinkDB All DBs
Position
11
AA seq 178 aa AA seqDB search
MAGAVLNPVNIRLNASTIAFLLGHCTAAAVIVDQEFFSLAEEALKIWSEKAKTFNPPLLV
VIGDENCDPKTLRYALGKGAIEYEDFLQSGDPEYAWIPPEDEWQSISLGYTSGTTASPKG
VVLHHRGAYLMSLSGALIWGMTEGAVYLWTLPMFHCNGWCFTWTLAALCGTNICLRQL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggctgtgctgaaccctgttaacattaggctaaatgcatccacaatagctttt
cttcttggtcattgcacagctgcagcagtaatagttgatcaagagttcttttctttggca
gaagaagctttgaaaatatggtctgagaaagccaagaccttcaacccaccactacttgtt
gtcattggtgatgaaaactgcgaccctaagacacttaggtatgctctgggaaaaggagcc
attgaatatgaggattttctccaaagtggtgaccctgaatatgcatggatacccccggag
gatgagtggcagagcatatctttgggttacacatctggtaccaccgctagtccgaagggt
gtggtgttgcaccaccgaggagcctatctcatgtctctgagtggcgctcttatttgggga
atgactgaaggtgctgtgtatctttggacactgccaatgtttcattgcaatggttggtgt
ttcacgtggacacttgcagctctgtgcggtacaaacatatgtcttcgccagctttaa

KEGG   Cajanus cajan (pigeon pea): 109811435Help
Entry
109811435         CDS       T04868                                 

Definition
(RefSeq) acetate/butyrate--CoA ligase AAE7, peroxisomal
  KO
K01913  acetate/butyrate---CoA ligase [EC:6.2.1.1 6.2.1.2]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00620  Pyruvate metabolism
ccaj00630  Glyoxylate and dicarboxylate metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109811435
   00620 Pyruvate metabolism
    109811435
   00630 Glyoxylate and dicarboxylate metabolism
    109811435
   00650 Butanoate metabolism
    109811435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccaj01004]
    109811435
Enzymes [BR:ccaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     109811435
    6.2.1.2  medium-chain acyl-CoA ligase
     109811435
Lipid biosynthesis proteins [BR:ccaj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   109811435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 109811435
NCBI-ProteinID: XP_020230778
LinkDB All DBs
Position
Unknown
AA seq 566 aa AA seqDB search
MTMGRDIDDLPKNDANHTALTPLWFLERAALVHPSRISVVHGSQHYTWHQTHQRCRRLAS
ALSNLSIGLGHTVGVLAPNIPALYEAHFGIPMAGAVLNTINIRLSASRIAFLLAHSSAAA
VIVDQELFSLLEESLKICSEKSKSFKPPMLVVVGDESCHPNDLRHALAKGVIEYEKFLES
GDPEFKWKPPQDEWQSIALGYTSGTTASPKGVVLHHRGAYLMSLSGALNWGMKEGAVYLW
TLPMFHCNGWCYPWTLAALCGTNICLRKVTAKAIYEAIAEYKVTHFCAAPVVLNSIVNSS
PEEAILPLPHVVHVNTAGSAPPPSVIAAMSELGFRVTHTYGLSETYGPSTVCTWKPEWES
LPIEKLAQLSARQGVRYIGLEGLEVMNTKTMQPVPADGATVGEIVMRGNAVMKGYLKNPK
ANKEAFANGWFHSGDLAVKHPDGYIEIKDRSKDIIISGAENISSVEVENALYSHPAILDA
SVVARPDEKWGESPCAFVTLKPGVDSSNEQRLVEDIVKFCRSKMPAYSVPKSVVFGPLPK
TATGKTQKHLLREKAKEMGPVRKSKL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggggcgcgacatagacgatttgccgaagaacgatgcgaaccacactgccttg
accccgctatggttcttggaaagagcagctctggtgcaccccagcagaatatccgtggtc
catggatcacagcactacacgtggcaccaaactcaccagcgttgccgtcgactcgcctct
gctctttccaacctttccatcggtctcggccacactgttggtgttcttgcacccaatata
ccagccctttatgaagctcattttgggattccaatggcaggagctgtgttgaacactatt
aacattcgcctaagtgcatccagaatagctttccttcttgctcattcatccgctgcagcc
gtcattgtggatcaagagttattttccttgttggaagagtccttgaagatatgttctgag
aaaagcaaaagctttaagcctccgatgttagttgtcgttggcgatgaaagctgccacccc
aatgatctcagacatgctttggcaaagggagtcattgagtacgagaaattccttgagagc
ggggaccctgaattcaagtggaaacctcctcaggatgagtggcagagcatcgctttgggt
tacacatctggtaccacagctagtcctaagggtgtggtgttgcaccaccgaggggcgtat
ctcatgtctctaagtggagctcttaattggggcatgaaggaaggtgctgtgtatctgtgg
acacttcccatgtttcattgcaatggctggtgctatccttggacacttgcggctctttgt
gggactaacatttgtcttcggaaggtaacagctaaggcaatctatgaagccattgcggag
tacaaagtcactcatttttgtgcagcaccagtggttcttaactcaatagtcaattcctct
cctgaggaagccatccttcctctaccccatgttgtacatgtgaatacagcagggtcagct
cctcctccatctgtaattgctgccatgtctgaactaggatttcgtgtcactcacacatac
ggtctctcagaaacctacggcccctccacggtatgcacctggaagccagagtgggaatca
cttcccatcgaaaagctagctcagctgagtgcgaggcaaggggtgcggtacattggcttg
gaaggcctagaagtcatgaacacaaaaaccatgcagcctgttcctgctgatggtgccact
gttggtgagattgtgatgaggggcaatgctgtgatgaaaggatacctgaagaaccccaaa
gctaacaaagaggcctttgcaaatggatggtttcattctggtgatctggctgtgaagcat
cctgatggatacattgaaattaaggacaggtcaaaggacatcatcatatcaggtgctgag
aatattagtagtgttgaagtagagaatgctctatactctcatcctgcaatacttgatgca
tcagtggttgcaaggccagatgagaagtggggtgagtcaccttgtgcttttgtgacactg
aagccaggagtggatagtagtaatgagcaacgtttggttgaggacatcgttaagttctgt
aggtccaagatgcctgcttattcggtaccaaaatcagttgtgtttggaccattgccaaag
acagcaactgggaagacgcagaagcacttgctgagggaaaaggcaaaggagatggggcct
gttagaaagagcaagttgtaa

DBGET integrated database retrieval system