KEGG   Cajanus cajan (pigeon pea): 109808378Help
Entry
109808378         CDS       T04868                                 

Definition
(RefSeq) probable enoyl-CoA hydratase 1, peroxisomal
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00310  Lysine degradation
ccaj00360  Phenylalanine metabolism
ccaj00380  Tryptophan metabolism
ccaj00410  beta-Alanine metabolism
ccaj00640  Propanoate metabolism
ccaj00650  Butanoate metabolism
ccaj00903  Limonene and pinene degradation
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01212  Fatty acid metabolism
Module
ccaj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109808378
   00650 Butanoate metabolism
    109808378
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109808378
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109808378
   00310 Lysine degradation
    109808378
   00360 Phenylalanine metabolism
    109808378
   00380 Tryptophan metabolism
    109808378
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109808378
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    109808378
Enzymes [BR:ccaj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     109808378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 109808378
NCBI-ProteinID: XP_020226955
LinkDB All DBs
Position
11
AA seq 264 aa AA seqDB search
MDRQSPENLILVSRDPNGVALVTINRPASLNSLTRPMMVDLAQAFKRLDRDESVRAIILT
GSGRSFCSGVDLTAAEDVFKGDVKDPESDPVVQMERCRKPIIGAIKGFAVTAGFEIALAC
DILVASKGSKFMDTHARFGIFPSWGLSQKLSRIIGVNKAREVSLTATPLTAEVAEKLGFV
NHVVDDSEVLKKSREIAEAIVKNNQDLVLRYKEVINDGIKLDLGTALSLEKERAHDYYNG
MTKEQFRKMQEFIAGRGSKKQSKL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggatcgccaatcgccggagaatctcatactcgtgagccgcgacccaaacggcgtcgct
ctggtcaccattaatcggcccgcttctctcaactcgctcacccggcccatgatggtggac
ctggcccaggccttcaagagactggaccgggacgaatcggtgcgggccatcatactaacc
gggtcgggccgctcgttctgttcgggcgtggatctcaccgccgcagaggacgtcttcaag
ggcgacgtgaaggacccggagagcgacccggtcgtgcaaatggagcgttgccgcaaaccg
ataatcggagccattaaaggattcgccgtcactgcgggattcgaaatcgccctcgcctgc
gatattttagttgcttccaagggatctaagttcatggatactcatgccaggtttgggata
tttccttcgtggggcttgtctcagaagctttcgcgcatcataggggtgaataaagcccgt
gaggtgtctctcacggccacgcctttgactgcggaggtagcagaaaaattgggtttcgtg
aaccatgtggttgacgacagtgaagtgttgaagaaaagcagggaaatcgctgaggccatt
gtgaagaataaccaagacttggtgttgaggtacaaggaggttatcaatgatggcatcaag
ctggatcttggcactgcactttcccttgaaaaggaaagggctcatgattattataatgga
atgacaaaggaacaattcaggaagatgcaggaattcatagctggtcgaggttccaagaaa
cagtccaaactgtag

DBGET integrated database retrieval system