KEGG   Cajanus cajan (pigeon pea): 109808416Help
Entry
109808416         CDS       T04868                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00053  Ascorbate and aldarate metabolism
ccaj00071  Fatty acid degradation
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00310  Lysine degradation
ccaj00330  Arginine and proline metabolism
ccaj00340  Histidine metabolism
ccaj00380  Tryptophan metabolism
ccaj00410  beta-Alanine metabolism
ccaj00561  Glycerolipid metabolism
ccaj00620  Pyruvate metabolism
ccaj00903  Limonene and pinene degradation
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109808416
   00053 Ascorbate and aldarate metabolism
    109808416
   00620 Pyruvate metabolism
    109808416
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109808416
   00561 Glycerolipid metabolism
    109808416
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109808416
   00310 Lysine degradation
    109808416
   00330 Arginine and proline metabolism
    109808416
   00340 Histidine metabolism
    109808416
   00380 Tryptophan metabolism
    109808416
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109808416
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    109808416
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109808416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 109808416
NCBI-ProteinID: XP_020227002
LinkDB All DBs
Position
11
AA seq 536 aa AA seqDB search
MAFSLRISRLISRSFSSTSLLSRGGSGYLGSGHCKYSTAAATEEEPIKPSVQVEHTQLLI
DGKFVDAASGKTFPTLDPRTGEVIANVAEGKSEDVDRAVAAARKAFDHGPWPKMTAYERQ
RILLRIADLVEKHNDEIAALETWDNGKPYEQSSKIEIPMLVRLIRYYAGWADKIHGLTVP
ADGPYHVQTLHEPIGVAGQIIPWNFPLLMFGWKVGPALACGNTIVIKTAEQTPLSALYVA
QLFHEAGLPPGVLNVVSGFGPTAGAALASHMEVDKLAFTGSTDTGKVVLELAAKSNLKPV
TLELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFVEKAKAR
ALKRVVGDPFKGGIEQGPQIDSEQFEKILRYIRSGVENGATLETGGDRLGNKGFYIQPTV
FSNVKDGMPIAKEEIFGPVQTILKFKDLGEVVQRANNSRYGLAAGIFTQNIDTANSLTRA
LRVGTVWTNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNPAWL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggctttttctctcagaatctcaaggctcatctctcgctcattttcttctacatcctta
ctttctcgaggtgggagtggttaccttggttcaggacattgtaaatacagcaccgctgct
gccactgaagaagaacccattaaaccatcagtgcaagtggaacatacgcaactcttaatt
gatgggaaattcgtggatgctgcttctggtaaaacttttccaactttggatcccaggaca
ggggaagtgattgctaatgttgctgagggtaaatctgaagatgttgatcgagcagttgca
gctgcacgcaaagcttttgatcatggaccatggcctaagatgacagcatatgaaaggcaa
aggatcttgttgcgtatagctgatctggttgaaaagcacaatgatgagattgcagcactt
gagacttgggataatggaaagccttatgaacaatcttctaagattgaaattccaatgctg
gttcgccttattcgatactacgctggttgggcagataagattcatggtcttacggttcca
gctgatggaccttatcatgtgcaaacattgcatgaacctattggtgtggcgggtcagatc
attccttggaacttccctcttctcatgtttggttggaaggttggaccagcattggcctgt
ggcaacacaattgttatcaaaacagctgagcagacaccattgtctgctttatatgtagca
caactatttcatgaggctggacttcctcctggtgttttgaatgtggtatcaggctttggt
ccaactgctggtgctgctcttgctagtcacatggaagttgataagcttgctttcactggt
tccactgatactggaaaagttgttcttgaactggcggctaaaagcaaccttaaacctgta
actttggagcttggtgggaaatcaccctttattgtgtgtgaagatgctgatgtagatcag
gctgttgagcttgcacactttgctttattctttaatcagggacaatgttgctgtgctggt
tctcgaacatttgtacatgaaagtgtctacgatgagtttgttgagaaagcaaaggctcgt
gctttgaaacgtgttgttggtgatcctttcaaggggggaatagagcaaggtcctcagatt
gattcagaacaatttgagaaaatactgaggtatatcagatctggtgttgaaaatggggct
acccttgaaaccggaggagacaggcttggcaacaaaggcttctacattcaacctactgtc
ttctcaaatgttaaggatggcatgccgattgcaaaggaagagatctttggtccagtccaa
accatattaaaattcaaggaccttggtgaggtagttcaaagagcaaataactcacgttat
gggcttgcagcagggatattcacacagaacatagacactgcgaactctttgacaagggca
ctgagggttggaacagtgtggacaaactgctttgacacatttgatgctgcaattcctttt
ggagggtacaaaatgagtggtcagggcagagaaaaaggagagtatagtctcaagaactac
ttgcaagtgaaggctgttgttacttccttgaagaacccagcatggctttga

DBGET integrated database retrieval system