KEGG   Cajanus cajan (pigeon pea): 109809471Help
Entry
109809471         CDS       T04868                                 

Definition
(RefSeq) putative deoxyribonuclease TATDN1
  KO
K03424  TatD DNase family protein [EC:3.1.21.-]
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109809471
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     109809471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TatD_DNase
Motif
Other DBs
NCBI-GeneID: 109809471
NCBI-ProteinID: XP_020228388
LinkDB All DBs
Position
11
AA seq 319 aa AA seqDB search
MAGIRMIDIAVNFTDGMFMGIYHGKQCHVSDIATVLNRAWAAGVQRIIVTGGSLEESREA
LAIAETDGRLFCTVGVHPTRCKEFEESGDPEKHFQALLSLAKEGIQKGKVVAIGECGLDY
DRLHFCPVEIQKKYFEKQFELAYITKLPMFLHMRAAATDFCEIMEKNKDRFTAGVTHSFT
GSLDDCIKLLSFDKMYIGINGCSLKTTENIDVVKSIPVERMMIETDSPYCEIKNTHAGIG
FVKSTWPSKKKEKYDQESIVKGRNEPCLVRQVLEVVAGCKGIDDVGNLSRTLYNNTCRIF
FPHDLDSAADALLAGGNSS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtattcgaatgatagatatagccgtcaacttcaccgatggcatgtttatggga
atctaccacggcaagcaatgtcacgtctcagatattgcaaccgttttgaacagagcatgg
gctgctggtgtccaaagaattattgtaacaggtggatccctggaggaatcaagggaagcg
cttgcaattgcggaaacagatggacgacttttctgcacagttggtgtgcatccaacacgt
tgcaaggaatttgaggagagtggagatccagaaaagcattttcaggctctcttgtcttta
gctaaagagggaattcagaaaggaaaggtggttgcaattggagaatgtggattggactat
gacaggcttcatttttgtccagtagagattcaaaagaagtattttgagaagcaatttgaa
ttagcatatatcacaaaactgcctatgtttttgcacatgcgagcagctgccacagatttc
tgtgaaataatggagaaaaataaggacaggttcactgctggagtcactcattcatttact
ggtagtttggatgattgcattaagcttctctcatttgataaaatgtacatagggataaat
gggtgctctctgaagacgaccgagaacattgatgttgtgaagagtattcctgttgagaga
atgatgattgagacagactcaccgtactgtgaaatcaagaatactcatgctggtattggt
tttgttaaatctacatggccttctaagaagaaagagaagtatgatcaagagagcattgtt
aaaggccgcaatgaaccttgtttagttaggcaagttcttgaagtagttgctggctgtaaa
ggcatcgatgatgtgggcaatcttagcagaacattgtacaacaacacttgcaggattttt
ttccctcatgacttggactctgcagctgatgctcttcttgctggcggtaattcttcataa

DBGET integrated database retrieval system