KEGG   Cajanus cajan (pigeon pea): 109811393Help
Entry
109811393         CDS       T04868                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic 1-like isoform X1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00072  Synthesis and degradation of ketone bodies
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00310  Lysine degradation
ccaj00380  Tryptophan metabolism
ccaj00620  Pyruvate metabolism
ccaj00630  Glyoxylate and dicarboxylate metabolism
ccaj00640  Propanoate metabolism
ccaj00650  Butanoate metabolism
ccaj00900  Terpenoid backbone biosynthesis
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01212  Fatty acid metabolism
Module
ccaj_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109811393
   00630 Glyoxylate and dicarboxylate metabolism
    109811393
   00640 Propanoate metabolism
    109811393
   00650 Butanoate metabolism
    109811393
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109811393
   00072 Synthesis and degradation of ketone bodies
    109811393
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109811393
   00310 Lysine degradation
    109811393
   00380 Tryptophan metabolism
    109811393
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    109811393
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109811393
Enzymes [BR:ccaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     109811393
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109811393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-GeneID: 109811393
NCBI-ProteinID: XP_020230731
LinkDB All DBs
Position
Unknown
AA seq 409 aa AA seqDB search
MSTSTKSRDVCIVGVARTPMGGLLGTLSSLSAIELGSIAIKAALKRANVDPSLVQEVFFG
NVLSANLGQAPARQAALGAGIPTSVICTTINKVCSSGMKATMLAALTIQSGLNDVVVTGG
MESMSNAPKYIVEARKGSRYGHDTIIDGMIKDGLWDVYNDFGMGVCAELCADEQVITRDE
QDSYAVRSFERGISAQNAGHFSWEIVPVEVSSGRGKPSTLVDRDEGLGKFDAAKLRKLRP
SFKKVGGSVTAGNASSISDGAAALVLVSEEKARELGLHVIAKIKGYGDAAKAPELFTTAP
SLAIPKAISNAGLEASQIDYYEINEAFSVVALANQKLLGLNPEKVNVHGGAVSLGHPLGC
SGARILVTLLGVLRQKRGKYGVAAICNGGGGASALVLELMPVAVGRSLL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtctacttcaacaaaatcccgagatgtttgtattgttggtgttgctcggacgccaatg
ggtggtttacttggcaccctatcatctctctctgccatagagttaggctcaattgctatt
aaggctgctctcaagagagcaaatgttgatccatcacttgtgcaagaggtgttttttggg
aatgttcttagtgcaaatttagggcaggctcctgccagacaggctgctttaggtgcagga
atacctacatctgtaatctgcactactattaacaaggtgtgttcatcagggatgaaagct
accatgcttgcagcactgaccatacaatctggtctcaatgatgttgttgtgactggtggt
atggaaagcatgtcaaatgcacccaagtacattgtagaagccaggaagggatctcggtat
ggacatgatactatcattgatggaatgatcaaagatggcctttgggatgtctataatgac
tttggcatgggagtttgtgccgaactatgtgcagatgagcaagtcataacaagagatgag
caggactcttatgccgttcgaagctttgagagaggaatatctgcacaaaatgctggtcat
ttttcttgggagatagttccggttgaagtttccagtggaagaggaaagccttccacactt
gttgatagagatgaaggtttggggaagttcgatgctgcaaagttaaggaagcttagacca
agctttaaaaaagttgggggctctgtgactgctggcaatgcttctagtataagtgatggt
gctgcggcattagtgctagtgagtgaagagaaggctcgtgagcttggattgcatgtaatt
gcaaagataaaaggatatggagatgcagctaaggcacccgaattatttacaactgctcct
tcccttgcaatcccaaaagctatatcaaatgctggtcttgaggcttctcaaattgattat
tatgaaataaatgaagccttttcggttgtggctcttgcaaatcagaagcttcttggtctt
aatcctgaaaaagtgaacgttcatggtggagctgtatcattggggcatcccttgggttgc
agtggagctcgcatcttagtcacattattaggggtattgaggcagaagagagggaagtat
ggtgtggctgccatctgcaatggaggaggaggagcatctgctcttgtccttgagctcatg
ccagttgctgtgggacgttcgttattatga

KEGG   Cajanus cajan (pigeon pea): 109814357Help
Entry
109814357         CDS       T04868                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic 1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00071  Fatty acid degradation
ccaj00072  Synthesis and degradation of ketone bodies
ccaj00280  Valine, leucine and isoleucine degradation
ccaj00310  Lysine degradation
ccaj00380  Tryptophan metabolism
ccaj00620  Pyruvate metabolism
ccaj00630  Glyoxylate and dicarboxylate metabolism
ccaj00640  Propanoate metabolism
ccaj00650  Butanoate metabolism
ccaj00900  Terpenoid backbone biosynthesis
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01212  Fatty acid metabolism
Module
ccaj_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109814357
   00630 Glyoxylate and dicarboxylate metabolism
    109814357
   00640 Propanoate metabolism
    109814357
   00650 Butanoate metabolism
    109814357
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109814357
   00072 Synthesis and degradation of ketone bodies
    109814357
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109814357
   00310 Lysine degradation
    109814357
   00380 Tryptophan metabolism
    109814357
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    109814357
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109814357
Enzymes [BR:ccaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     109814357
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109814357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt TrmE_N
Motif
Other DBs
NCBI-GeneID: 109814357
NCBI-ProteinID: XP_020234355
LinkDB All DBs
Position
Unknown
AA seq 404 aa AA seqDB search
MAPAAAESIKPRDVCIVGVARTPMGGFLGTLSSLPATKLGSIAIEAALKRANVDPSLVEE
VYFGNVLSANLGQAPARQAALGAGIPKSVICTTVNKVCASGMKAAMLAAQSIQLGINDVV
VAGGMESMSNVPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYKDVGMGVCAELCADNHSL
TREDQDNFAIRSFERGIAAQDSGAFSWEIVPVEVSGGRGKPSTVVDKDEGLGKFDAAKLR
KLRPSFKETGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQEPELF
TTAPSLAIPKAIARAGLETSKIDFYEINEAFAVVALANQKLLGLDSEKVNVHGGAVALGH
PLGCSGARILVTLLGVLKQKNGKYGVGGICNGGGGASALVVELL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctccagctgcagcagaatctataaagcctagagatgtttgcattgttggtgttgca
cgtacgccaatgggtggatttcttggtactttgtcatctctacctgccaccaagctgggc
tctattgctattgaagctgctcttaaaagggccaatgttgatccatcacttgtggaagaa
gtatattttgggaatgttcttagtgctaatttggggcaagctcctgcaagacaagctgct
cttggagcaggaatacctaaatcagtaatctgcactactgttaacaaagtttgtgcatcg
ggaatgaaagctgcaatgcttgctgcacagagtattcaattaggcataaatgatgttgtt
gtggctggtggtatggaaagcatgtctaatgtacctaagtacctggctgaagcaaggaaa
ggatcccgccttggacatgattcacttgttgatgggatgttgaaagatggtctgtgggat
gtctataaggatgttggcatgggagtgtgtgctgagctgtgtgcagataaccattcatta
acaagagaagaccaggataactttgcaattcggagttttgaacgtggaattgctgcccaa
gacagtggtgccttttcatgggaaattgttccggttgaagtctctggtggaaggggaaaa
ccatcaacagttgttgataaggatgaaggtttaggaaagtttgatgctgccaagttacgc
aaacttcggccaagtttcaaggagactggaggttctgttactgctggcaatgcttccagc
ataagtgatggtgctgctgcactcgttttggtgagtggagagaaggcactgaagcttggg
cttcaagttattgcaaaaatcactggatatgctgatgctgctcaggaaccagagttattt
acaacagctccatcccttgccattcccaaagctattgccagggcagggttggagacttca
aaaattgatttttacgaaattaatgaagcttttgcggttgtggctcttgccaatcagaaa
cttcttggacttgattcggaaaaagtaaacgtacatggtggagctgttgcactgggtcat
cctcttggttgcagtggtgctcgcattctggtgacacttttgggggtactgaagcagaag
aatgggaagtatggagttggtggcatttgcaatggaggaggtggtgcatctgcccttgtt
gtggagcttctgtag

DBGET integrated database retrieval system