KEGG   Cajanus cajan (pigeon pea): 109811449Help
Entry
109811449         CDS       T04868                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00052  Galactose metabolism
ccaj00500  Starch and sucrose metabolism
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109811449
   00500 Starch and sucrose metabolism
    109811449
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109811449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 109811449
NCBI-ProteinID: XP_020230795
LinkDB All DBs
Position
Unknown
AA seq 928 aa AA seqDB search
MNMLPSLLSLLKPTSALRQSMATPTRWRTEATTIITTPLLILSICVHFFFCSVTIAEDTP
IGYGYTISTVTNYPINNSLTANLKLIKPSSVFGPDIPRLSLAASFENKDRLRVRITDSNH
QRWEIPQQVIPRDSSSQYYPLRSLNSQQGSQHSLTLTHPDSDLIFTLHNTTPFGFTVLRK
SSNDVLFNAAPDPSNPQTFLVFKDQYLQLSSSLPPQRASLYGLGEHTKRSFKLQPNETLT
LWNADIASANVDVNLYGSHPFYLDVRSPSDDGRVKAGTTHGVLLLNSNGMDIVYAGDRIT
YKVIGGVFDLYFFAGSSPQLVLEQYTELIGKPAPMPYWSFGFHQCRWGYKNVSDIQGVVA
NYAEAGIPLEVMWTDIDYMDAYKDFTFHPVNFPLDKMKSFVDSLHQNGQKYVLILDPGIS
TNETDATHVRGLKADIYIKRNGVNYEGQVWPGPVYYPDFLNPRSQAFWGGEIKLFRDLLP
FDGLWLDMNELSNFITSPPILSSSLDNPPYKINNQGDRQNINYKTVPATALHFGNVTEYN
AHSLYGLLEAKATNKALVDTTGKRPFILSRSTFVSSGKYTAHWTGDNAATWNDLAYSIPS
ILNFGLFGIPMVGADICGFGGDTTEELCRRWIQLGAFYPFARDHSDKSSIRQELYLWDSV
ATSARKVLGLRYRLLPYFYTLMYEAHTKGTPIARPLFFSFPEDVTTYEINSQFLLGKGVL
VSPVLEPGAINVDAYFPKGTWFDLFNVSNSVNAESGKHVTLDAPSDHINVHVGEGNILAL
QGEAMTTEAARNTSFELVVVISGSGNSYGQVYLDDGVALDIAGVKDQWTLVNFYGTLHNN
SIFVTSKVTNGRFALDKRWIIDKVTVLGMPKQRMDLARKKLNIVKGTKSMRKAIVKTQFN
SSYELDIVELSKLSQLIGEEFKLEIEIR
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgccatcgttgctatccttactcaaacccacatcagcactaaggcaatca
atggctacacctacaaggtggaggactgaagccacaaccattatcaccactccactacta
atccttagtatctgtgttcatttcttcttctgctccgttacaatagcagaagatacacca
attggttatggctacacaatctcaactgttaccaattatcccattaacaactctttgact
gcaaaccttaagctcatcaaaccatcctctgttttcggacccgacattccacgcctctcc
ctcgctgccagttttgagaacaaggataggttgagagtaagaatcactgactccaaccac
caaagatgggaaattccacaacaagtcattccaagagactcttcttcccaatattaccct
cttcgctccctcaatagccaacaaggttcccaacactctctcactctcacacatccagac
tcagaccttatcttcactctccacaacaccaccccatttggtttcacggtcttacgcaaa
tcctccaacgatgtcctcttcaacgcagcacctgacccttccaacccccaaacttttctt
gttttcaaagatcagtatttgcaactctcttcctctcttccaccacaaagggcatctcta
tatggtctcggggagcacacaaagaggtccttcaagctgcaaccgaatgagaccctcacg
ctgtggaatgcagacatagcaagtgccaacgtggatgtgaacctttatggctctcaccct
ttttacttggacgtgagatcaccctccgatgatggaagagtgaaggctggcaccacacat
ggggtgttgttacttaacagcaatggaatggacattgtctatgccggtgatcgcattact
tataaggtcattggtggagtttttgatctctatttcttcgctggatcctctcctcaactg
gtcttggagcagtacactgaactcattggcaaacctgctcccatgccttattggtccttt
ggttttcatcagtgtcgatgggggtacaagaatgtaagtgatatccagggtgtggtggcc
aactatgcagaagccggtataccccttgaagttatgtggacggatatagattacatggat
gcatataaggatttcacatttcatcccgtcaactttcccctggataagatgaaaagtttt
gttgactctcttcaccaaaatggtcagaaatacgtgcttatcttggatcctggtattagt
acaaatgagacagatgcaacacatgttagaggtttgaaagctgatatctacataaagaga
aatggagtcaattatgagggtcaagtttggcctggaccagtttattaccctgattttcta
aaccctcgcagccaagcattttggggtggagaaatcaaattatttagggatcttctccct
tttgatggtctttggcttgatatgaatgagttatctaatttcattacttctcctcccatt
ctatcttctagtcttgataaccctccctacaaaattaacaatcaaggagatcgacaaaac
attaattacaaaacagtcccagcaacagctttacactttggtaatgtcactgagtataat
gcccacagtttgtatggactactagaagccaaagcaactaacaaggcattggtggataca
actggtaaaaggccattcattctaagtagatcaacttttgtaagctctggtaagtacact
gctcactggacaggagataatgctgctacatggaatgatttggcatactcaataccctcc
atattaaattttggactctttggaattccaatggttggagcagacatatgtggttttgga
ggagatacaactgaagaactttgccggcgctggatccagttgggggccttttaccctttt
gcaagagatcattcagacaagagctccatccgacaagagctttacctttgggattcagtt
gcaacatcggctaggaaagtgcttggcctccgttaccgtctcctcccttatttctacaca
ctaatgtacgaagcacatacaaaagggacaccaattgcacgaccccttttcttttcattc
cctgaggatgtcacaacatatgaaataaactcacagtttctattaggtaaaggggttctg
gtgtcacctgtgctagaacctggggcaatcaatgttgatgcatactttcctaaaggaacc
tggtttgacctcttcaatgtctcaaattcagtgaacgcagaatcaggcaagcatgtcact
cttgatgctccatctgatcacataaatgtgcatgttggggagggtaatattttggccttg
caaggtgaagcaatgacaactgaagccgctaggaacacttcatttgaacttgtggtggtt
atcagtggcagtggcaatagttatggacaagtgtatttggatgatggggtggcacttgac
atagcaggggtgaaagatcagtggacattggtaaacttttatggcacattacacaacaat
agtatttttgttacatctaaggtcactaatggaaggtttgctctggacaaaagatggatc
atagataaggtaactgtgttggggatgcctaagcaaagaatggatttggcaaggaaaaag
ttaaacattgtgaagggaacaaagtcaatgaggaaagcaattgtgaaaacacaatttaat
agctcttatgagcttgatattgtggaactttcaaaattgtcgcagcttattggagaggag
tttaagctggagattgaaatcaggtag

DBGET integrated database retrieval system