KEGG   Cajanus cajan (pigeon pea): 109812305Help
Entry
109812305         CDS       T04868                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00500  Starch and sucrose metabolism
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109812305
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     109812305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 109812305
NCBI-ProteinID: XP_020231823
LinkDB All DBs
Position
Unknown
AA seq 421 aa AA seqDB search
MDSLSRFSLFCLFLSLFPLFASPALLFQGFNWESSSKGGWYNSLKNTISDLANAGITHVW
LPPPSQSVAPQGYLPGRLYDLDASKYGSKDELKSLIAAFHEKGIKCLADIVINHRTAERK
DGRGIYCIFEGGTPDARLDWGPSFICKDDTAYSDGTGNLDSGEGYDAAPDIDHLNPQVQR
ELSEWMNWLKAEIGFDGWRFDFVKGYAPSITRIYMEQTRPDFAVGEKWDSLSNGQDGKPN
YNQDGHRGALVNWVESAGGAVTAFDFTTKGILQAAVEGELWRLKDPNGKPSGMIGVKPEN
AVTFIDNHDTGSTQRLWPFPSDKVMQGYAYILTHPGTPTIFYDHFFDWGLKEQISKLSEI
RVRKGINEKSNVNILAADADLYVAKIDDKIIVKIGPKMDLGNLIPSNFRVATSGQDYAVW
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggattcgctctctcggttcagccttttttgcctcttcctttccctctttccccttttt
gcttcccctgccttgctgtttcaggggttcaactgggaatcaagtagcaaagggggttgg
tacaactctttgaagaacactatttctgatcttgcaaatgctggaattacccatgtttgg
ctccctcctccctctcaatctgttgctcctcaagggtatcttccgggaaggctatatgat
ctggatgcatcaaagtatggatccaaggatgaactgaagtccctaattgctgctttccat
gaaaaggggatcaagtgtctagctgacatagtcatcaaccacagaacagcagagagaaaa
gatggaagaggcatatactgcatctttgaaggtggcacaccagatgcacgtcttgattgg
ggtccatctttcatatgcaaagatgacactgcttactctgatggcactggaaacctcgac
agtggtgagggctatgatgctgcaccagacattgaccatctcaatccacaggtgcagaga
gagttgtctgagtggatgaactggctcaaagctgagattggttttgatgggtggaggttt
gattttgtcaagggctatgcccccagcattaccagaatttatatggagcaaactaggcct
gattttgcagtgggagagaaatgggattctctctctaatggccaggatgggaagcctaac
tataaccaagatggtcaccgtggggcactggtcaattgggttgagtctgcaggtggggct
gtcactgcctttgatttcacaaccaaaggaattcttcaggctgctgtggaaggggaactg
tggaggctgaaggatccaaatgggaagccaagtggaatgattggtgtgaaaccagaaaat
gcagttacctttattgacaaccatgatactggttccactcagagactttggccattccca
tctgacaaagtcatgcaaggatatgcttacattctaacacatcctgggaccccaacaata
ttctacgatcacttctttgattggggtttgaaggagcaaatatcgaaattgagtgagata
agggtgaggaaagggatcaatgagaaaagcaacgtgaatattctggcagctgatgctgac
ctttacgttgcaaagattgacgacaagataatagtgaagatagggccaaagatggacctt
ggaaaccttattccctctaatttccgcgttgctacctctggccaagactatgccgtgtgg
gagtga

DBGET integrated database retrieval system