KEGG   Cajanus cajan (pigeon pea): 109814176Help
Entry
109814176         CDS       T04868                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00410  beta-Alanine metabolism
ccaj00430  Taurine and hypotaurine metabolism
ccaj00650  Butanoate metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Module
ccaj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109814176
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109814176
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109814176
   00430 Taurine and hypotaurine metabolism
    109814176
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109814176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109814176
NCBI-ProteinID: XP_020234133
LinkDB All DBs
Position
Unknown
AA seq 501 aa AA seqDB search
MVLSKTASQTDVSVHSTFASRYVRASLPRFKMPEQSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEESETAVG
VGTVGSSEAIMLAGLAFKRRWQNRRKQEGKPIDSPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKSLNDLLLAKNEETGWNTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKMVMENCTDNMVVLKEGLEK
TGRFAIVSKDVGVPLVAFTLKDRNHFDEFQISDMLRRYGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVSDVTKVLHELDSLPARVISNTVTAAGEDVDNGAKVLVAKKSEIETQ
REITSAWKKFVMERKKMNCVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttctttcgaaaactgcctctcagacagatgtctctgtccattcaaccttcgcctct
cgctatgtccgcgcctccctccccaggttcaagatgccggaacaatcgattccgaaggaa
gcggcgtaccagatcataaacgacgagctgatgcttgacgggaaccctcggctgaacctg
gcctcctttgtgacgacgtggatggagcctgaatgcgacaaactcatcatggctgccatc
aacaaaaactacgtcgacatggatgagtaccctgtcaccactgagctccagaaccggtgt
gttaacatgatagctcatcttttcaatgcaccacttgaagagtcagaaactgcagttggt
gttggcaccgttggctcatcagaggccataatgttggctggattagcattcaaaaggagg
tggcaaaacagaaggaaacaagaagggaagccaattgacagtcctaacattgtcactggt
gccaatgttcaggtttgctgggagaaatttgcaaggtactttgaggtggagttgaaagag
gtgaagctgcgtgatggatactatgtaatggaccctgaaaaggctgtggaaatggtggat
gagaacaccatttgtgttgcggccatccttggttccactctgaatggagagtttgaagat
gttaagagcttaaacgatctcctcctggcaaagaatgaggaaactggatggaacactcca
attcatgtggatgcagccagtggtggattcattgcaccctttctttatccagagctagag
tgggattttcggttaccactagtgaagagcatcaatgttagtggacacaaatatggtcta
gtctatgctggaattggttgggtcatttggagaagcaaggaagaccttcctgacgaactc
attttccacattaactatcttggagctgatcaacccaccttcaccctcaacttctccaaa
ggttctagccaagttattgctcagtactaccaactcattcgattgggttatgagggctat
aaaatggtgatggaaaactgcacagacaacatggtagtgctgaaggaaggactagagaaa
acagggcggtttgcaattgtatcgaaagacgttggtgtgccattggttgcgttcacattg
aaggatcgtaaccactttgatgaattccaaatctctgatatgctgaggcgttatggatgg
atagtgccagcatacacgatgcccccagatgcacagcatgtgacagtgctacgtgttgtg
atcagggaggacttttctcgcaccctcgccgagcgtcttgtgagtgatgtcaccaaagtg
ttgcacgagctcgattcgcttcctgctcgggtcatcagcaacaccgtcactgctgccgga
gaagatgtcgataatggggccaaggtgctcgttgccaagaagagtgaaattgagacacaa
agggaaatcacttcagcttggaagaagtttgtcatggagaggaagaagatgaactgtgtt
tgttaa

DBGET integrated database retrieval system