KEGG   Cajanus cajan (pigeon pea): 109815365Help
Entry
109815365         CDS       T04868                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    109815365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccaj03400]
    109815365
Enzymes [BR:ccaj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109815365
DNA repair and recombination proteins [BR:ccaj03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     109815365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C PTCB-BRCT RNA_ligase BRCT DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 109815365
NCBI-ProteinID: XP_020235663
LinkDB All DBs
Position
Unknown
AA seq 1177 aa AA seqDB search
MTEQTKLSVLCSLFTWTQRAKSSAKKRAKFRKFLDAFCTDRNFFPAVRLLLPNLDRHRGS
XXLKESVLATSLIDALGISRDSPDALRLVNWRKGGASTGATAGNFALVASEVLQRRQGTA
SGGLTIRELNELLDRLASAESRAEKILVLSTLIQKTNAQEMKWIIMIILKDLKLGISEKS
IFHEFHPDAEDLFNVTCDLKLVCEKLRDRNQRHKRQDIEVGKAVRPQLAKRVGNATEAWK
KLHGKEVVVECKFDGDRIQIHKNGTEIHFFSRNFIDHSEYAHAMSEIIIQNVLVDRCILD
GEMLVWDTSLKRFAEFGSNQEIAKAARDGLDSDRQLCYVAFDILYFGDTSVIHQTLKERH
EILCKIVRPMKGRLEILVPNGGINSHLSSGEPCWSFIAHTVDEVERFFKETIENRDEGIV
LKDCSSKWEPSDRSGKWLKLKPEYIQAGSDLDVLIIGGYYGSGRRGGEVAQFLVGLAERP
SPNTHPKRFISFCRVGTGLSDDELDAVVTKLKPYFRKYEYPKKRPPSFYQVTNHSKERPD
VWVDSPEKSIILSITSDIRTIESEVFAAPYSLRFPRIDRVRYDKAWHECLDVQSFIELVH
SSNGTTQRGTEYGSKQDNKPKQTKSSKRGEKKNMSIVPSHLIQTDVSSIKGSSLIFSNMM
FYFVNVPPSHSLESFHKIIAENGGTFSMNLNNSVTHCVAADSKGFKFEAAKRHGDIIHYS
WVLDSYAQKKLVCLHPKYFLFLSEQTKKKLQEEIDEFSDSYYLDLALGDIKQLLSNIHRS
EDVSTVDHYRKKYCPKDKWSLFYGCSIYFHTSIPSLKGDWHFILQLSLRRFKVEVLMGGG
KVTSNIACASHLVALLVPGCQTDFEEIESSFTSVERKFLRSKRLCIVKSQWLEDCSDSSQ
RLSEDSYSLKPWGIEESTAEDCEQDLVLEAHQSGYNVEDQNISNSVKGNQQRSAKAACED
SMALVSQEKGGQRKRGRPAGSGTKKVKPAAKQARRARVQNVKKPAKLYEYESSDESDSHD
KRPIEQEIDTSARSLDFYKKHSEPQESEERGYVQVAETVESSRPDNIDKQEDLKSNEHER
TLVPELEMADKHNEVSEKLEISADPLQAMLFDMIPSLATKKDEQPMNLSLREEKQPEISN
AEAEKLPESSNAEEEPTTIKKKKVSYKDVASQLLKDW
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcaaaccaagttgagcgtgttgtgcagcctcttcacgtggacgcagcgagcc
aagtcgtcggcgaagaagcgcgccaagttccgcaagttcctcgacgccttctgcaccgac
cgcaacttcttccccgccgtccgcctcctcctccccaacctcgaccgccaccgcggctcn
nnnnncctcaaggagtccgtcctcgccacctccctcatcgacgccctcggcatctcccgc
gactcccccgacgccctccgcctcgtcaactggcgcaagggcggcgcctccaccggcgcc
accgccggaaatttcgccctcgtcgcctccgaggtgctgcagcggaggcaggggacggct
tcgggtggattgacgatcagggagcttaatgagttgcttgacaggttggcttccgctgaa
agcagggctgagaaaattttggttctttctacccttatccaaaagactaatgcacaggaa
atgaagtggattatcatgataattctgaaagatctaaagctgggaattagtgaaaaaagc
atttttcatgagttccatcctgatgcagaagacttgtttaatgttacctgtgacttaaaa
ttagtatgtgaaaagctaagggatcgaaatcaacgtcataagcggcaggatattgaagtt
ggaaaagctgtacgcccccaattagctaagagagttggtaatgcaactgaagcatggaag
aagcttcatgggaaggaagtggttgttgagtgcaaatttgatggtgaccgcattcaaatt
cataaaaatggaactgagatacattttttctcaaggaactttattgatcattctgaatat
gcacatgcgatgtcagaaatcataattcaaaatgttcttgtagataggtgcatccttgat
ggtgaaatgttggtgtgggacacatccttgaaacgttttgctgagtttggctcaaatcag
gaaatagccaaggcagcaagagatggacttgatagtgatagacagttatgctatgttgca
tttgatatcctttattttggagatactagtgtgattcaccaaactttgaaggaacgacat
gagattttgtgtaaaattgtaaggccaatgaagggtcgtttggaaattttagtacctaat
ggtggtatcaacagccatctttcttctggtgaaccttgttggtcatttattgctcatact
gtggatgaagtcgagaggtttttcaaagaaaccattgaaaatagagacgagggaattgtt
ttaaaagactgcagctccaaatgggaacctagtgatcgtagtggaaagtggctgaaactg
aagccagaatacattcaagctggttctgatctggatgtacttatcataggtggttactat
ggttctggacgacgtggaggagaggttgctcagttcttggttggccttgcagagcgtcca
tccccaaatacacaccctaagcgatttatctccttttgcagagttggtactggactctct
gatgatgagcttgatgctgtagtaaccaaactaaaaccttacttcagaaagtatgaatat
ccaaagaagaggccaccaagtttttatcaagtaactaatcattcaaaggaaagacctgat
gtgtgggttgatagccctgagaaatcaattattctgtctataaccagtgacatccgaact
atagaatctgaggtatttgctgctccctacagtctgagatttcccaggattgacagggtg
agatatgataaagcttggcatgaatgccttgatgttcaatcatttatagaactagtacat
tctagcaatggtaccacacagaggggtacagaatatggcagcaagcaggacaataaacca
aagcaaacaaagtcctccaaaaggggagaaaagaaaaacatgtccattgttccttcgcat
ttaattcaaactgatgtttccagcattaaggggagttccttaatattttccaacatgatg
ttctactttgttaatgtgcctccatctcattctcttgagtcctttcacaaaataattgct
gagaatgggggaactttttcaatgaatttgaataactcagtcacgcattgtgttgcagca
gacagcaaggggtttaaattcgaagcagcaaaacgtcacggtgatatcattcattattct
tgggtattagattcctatgcacaaaagaagcttgtctgcttacatccaaagtacttcctc
ttcctatctgaacagacaaagaagaagttacaagaagaaattgatgagttctcagactct
tactacttggatcttgctcttggagacatcaagcagctcttaagcaatattcataggtca
gaagatgtcagcactgtcgatcattacaggaaaaaatactgtccaaaggataagtggtct
ttattttatggatgctccatttatttccacacttcaataccttcattgaaaggagattgg
cattttatattgcaactttctttgaggagattcaaggttgaagttctcatgggtggtgga
aaagttacctctaatattgcatgtgcatctcatttagtggccttgctcgttccaggatgt
cagactgactttgaagaaatagagagtagtttcacttcagtagaaagaaaatttctccga
agcaagaggctgtgcatagttaaatcccagtggttagaagattgttcagacagtagccaa
agattatcagaagactcttacagtttgaagccctggggaatagaagagtcaactgctgaa
gattgtgaacaggacttggtgttagaggctcatcagagtggatataatgtagaagaccaa
aatatttctaactctgtcaagggaaatcaacagagaagtgcaaaagctgcttgtgaagac
agtatggctttggtatcccaagagaagggtggccaaagaaaaagaggaagaccagcaggc
agtggtaccaaaaaagtaaaaccagctgccaaacaagcccgaagagcacgagtacaaaat
gtgaaaaagcctgctaagttatatgaatatgaatcatcagatgaaagtgattctcatgac
aaaagaccaattgagcaggagattgacactagcgcaagaagtcttgatttttacaagaaa
cattcagaaccccaggagagtgaggaacgtggatatgtccaagttgctgaaacagtggaa
agttctagaccagataatatagacaagcaagaagacttgaaaagcaatgaacatgaaaga
acattggttcctgaattagaaatggctgataagcacaatgaggtgtctgagaaacttgaa
atttcagctgaccccttgcaggcgatgttatttgacatgattcctagccttgccaccaaa
aaagatgagcaacctatgaatcttagtcttagagaagagaagcaaccagaaatctccaat
gcagaggcagagaagctaccagaaagctccaatgcagaagaagagcctacaactataaag
aaaaagaaagttagctacaaggatgttgctagtcagctgctgaaggattggtag

DBGET integrated database retrieval system