KEGG   Cajanus cajan (pigeon pea): 109817508Help
Entry
109817508         CDS       T04868                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00220  Arginine biosynthesis
ccaj00250  Alanine, aspartate and glutamate metabolism
ccaj00710  Carbon fixation in photosynthetic organisms
ccaj01100  Metabolic pathways
ccaj01200  Carbon metabolism
ccaj01210  2-Oxocarboxylic acid metabolism
ccaj01230  Biosynthesis of amino acids
Module
ccaj_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109817508
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109817508
   00220 Arginine biosynthesis
    109817508
Enzymes [BR:ccaj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     109817508
Amino acid related enzymes [BR:ccaj01007]
 Aminotransferase (transaminase)
  Class I
   109817508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 109817508
NCBI-ProteinID: XP_020238359
LinkDB All DBs
Position
Unknown
AA seq 525 aa AA seqDB search
MRKSAADRFRHLFNRSLLLRHHHHNPPPLSSSLSRPFSSMASDSPFPVTAHNINPKVLKC
EYAVRGEVVTLAQNLQKDLQANPGAHPFDEILYCNIGNPQSLGQAPITFFREVLALCDHP
TILDKSETQGLFSADAIERAWQIVDQIPGRATGAYSHSQGVKGLRDTIAAGISERDGFPA
NPDDIFMTDGASPAVHNMMQLLIRSENDGILCPIPQYPLYSASITLHGGNLVPYYLEEAT
GWGLEIPELKKQLDAAKSKGIHVRALVVINPGNPTGQVLSEENQRDIVEFCKQEGLVLLA
DEVYQENVYVPEKKFHSFKKVTRSMGYGEDDITLVSFQSVSKGYHGECGKRGGYMEVTGF
STEVREQIYKMASVNLCSNISGQILASLVMSPPKVGDESYESFMAEKGNILASLARRAKT
LEDAFNKLEGVTCNRAEGAMYLFPQIRLPGKAIKAAEEANTAPDNFYCKHLLNATGVVVV
PGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTEFHEKFMDEFRD
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaatccgcagctgacagattcaggcaccttttcaaccgttcacttcttcttcgc
catcatcatcacaatccccctcccctctcttcttctctctctcgccccttctcttccatg
gcttctgattcccctttccctgtcaccgctcacaacatcaaccccaaggttctgaaatgt
gagtatgctgttaggggagaagttgtcacacttgcgcagaatttgcaaaaggatttacag
gccaatcctggtgctcatccatttgatgagatactttactgcaacattggaaatcctcag
tctcttggccaggctccaataacttttttccgagaggttcttgcattatgtgaccatcca
actatattggacaaaagtgaaacacagggtttgttcagtgctgatgcaatagagcgagct
tggcagattgtggatcagattcctgggagagctaccggtgcctatagccatagtcagggt
gtcaagggcttgcgtgatacaatagctgctggaatttcagagcgtgatggttttcctgcc
aatcctgatgatattttcatgacagatggtgcaagccctgcagtccataatatgatgcaa
ttactcattagatcggaaaatgatggtattctgtgtcccattccacagtaccctctgtac
tcagcctcaattaccctccatggtggcaacctggtaccttattatttagaagaagctaca
ggttggggattggaaatacctgaactcaagaagcaattggatgctgccaagtcaaagggc
atccatgttagagctttagttgttataaatcctggcaatccaacagggcaggttctttct
gaggaaaatcagcgggatatagtggaattttgcaagcaagaaggtttggttcttttagct
gatgaggtatatcaagaaaatgtctatgttcctgagaagaaatttcactctttcaagaag
gtaactcggtccatgggatatggtgaggatgatatcaccttagtatcttttcaatcagtc
tcgaaaggctaccatggggagtgtgggaaacgaggaggttatatggaggtgactggattt
tctacagaagtgagggaacaaatatataaaatggcatctgtcaacctttgctctaatatc
tctggtcaaattcttgcaagcttggtcatgagcccacccaaggttggagacgagtcatat
gagtcattcatggctgagaaggggaatattttggcatcccttgctaggcgtgcaaagaca
ctagaagatgcattcaacaaattagagggtgtaacatgcaacagagcagaaggggcaatg
tatctgtttccccaaattcggctgcctggaaaggctatcaaagctgcggaggaagcaaat
acagcacctgataacttctattgcaaacacttgctcaatgccacaggagtagttgttgtt
cctggttctggttttggacaggttcctggcacatggcattttaggtgcacaatattgcct
caagaagagaagattccggccattgttacccgcttgacagagttccatgaaaaattcatg
gatgagttccgtgattaa

DBGET integrated database retrieval system