KEGG   Ceratina calcarata (carpenter bee): 108622110
Entry
108622110         CDS       T06061                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
ccal  Ceratina calcarata (carpenter bee)
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccal04052]
    108622110
   00536 Glycosaminoglycan binding proteins [BR:ccal00536]
    108622110
Cytokines and growth factors [BR:ccal04052]
 Growth factors
  Growth factors (RTK binding)
   108622110
Glycosaminoglycan binding proteins [BR:ccal00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   108622110
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 108622110
NCBI-ProteinID: XP_026667171
LinkDB
Position
Unknown
AA seq 220 aa
MSLRWIHENLEAPTCDEECSDIDDSCSDDSYDSDLSIDEEKGSGNEKEINGDCRKKRETR
RLQTGTVKYGENGTTRYLRSELAKHTPCVIWDPRKPAQNPVYNCVVIKLFCRTGYHLGVS
NSGRVRGFNATNEPHALLHIIPVAFGVIRIQSIQTSLYLAFNKKGRLYGEPNGSKDNTEW
EQWNVGSYDAFRSRKYQNYGWWIGIKKNGRAKPGSRTCWG
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagtcttcgttggattcacgaaaatttagaggcgccgacatgtgacgaggaatgcagc
gatatcgatgacagttgcagcgatgatagctacgattcagatttatcgatcgacgaagag
aaaggatcgggaaacgaaaaggagatcaatggtgattgtaggaaaaaaagggaaaccagg
agacttcagaccggcactgtgaagtacggagagaatggaactacgcgttatctgagatcg
gaattggctaaacacacgccttgcgttatatgggatcctaggaaaccggcacaaaatcct
gtgtacaattgtgtcgtaatcaaattgttctgtcgaactggatatcatcttggtgtatcg
aactctggtcgtgttcgcggtttcaatgcgacaaatgaaccgcatgctttactacacatt
ataccagtagcatttggagtaattcggatacaaagtattcagactagcctgtatttggct
ttcaataaaaagggccgtctttacggggagccaaatggaagtaaagacaacacagaatgg
gaacagtggaacgttggttcgtacgatgcttttcgatcgcgaaaatatcaaaattacgga
tggtggatagggataaaaaagaacgggcgtgcaaaaccgggatcaagaacatgctggggc

DBGET integrated database retrieval system