KEGG   Ceratina calcarata (carpenter bee): 108622113
Entry
108622113         CDS       T06061                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein-like isoform X4
  KO
K20017  Bcl-2 family protein
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal04214  Apoptosis - fly
ccal04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108622113
   04215 Apoptosis - multiple species
    108622113
SSDB
Motif
Pfam: Bcl-2 Haem_oxygenas_2
Other DBs
NCBI-GeneID: 108622113
NCBI-ProteinID: XP_017875270
LinkDB
Position
Unknown
AA seq 284 aa
MSGLVGSLRGLEDNSGNASQSYRRNSLALSLHSNLAAFPLANNNQEVSPFHVVDSARRRF
SNVSDVVSRKISHTIRWRTVSASVELTVSQGSSLCAQYIRNRLKRSGIFQRKLGLKRMRS
AMLLPGGTVVGEVYPELVAVGSELEKMHPNLFNRVARQIGCGTFSSEQAVTEAFVEVSRE
MIRIGEMTWSKVIALYAVAGGIGVDCVRQGKPEYLPAIQRGMTDVLEEDLATWIQANGGW
PALVTRYRPATNETTWYSSRLVPLFILITLIIFVISIFLKLLVL
NT seq 855 nt   +upstreamnt  +downstreamnt
atgtctggactcgttggatctctgcgcggcttggaggacaattccgggaatgcgagccag
tcgtatcgtaggaacagtctagctctgtcattgcactcgaatttggccgccttcccgtta
gcgaataataatcaagaggtatcgccgtttcacgtggtcgactcggcacgaagaagattc
agcaatgtcagcgacgtcgtttccaggaagatttcgcacacgatccgatggagaactgtt
tcggcatcagtagaacttaccgtgtcacaaggatcctcgctgtgcgctcagtatatccgg
aaccgcttgaagcgatccgggatttttcaacgaaaactcggattgaagaggatgaggagc
gctatgctgctccccggtggcacggtcgtcggcgaggtttatccggaattagtggcggtg
gggtctgagctagaaaagatgcatccgaatctgttcaatcgtgtcgcccggcagatcggt
tgcggcactttctcgtcggaacaagctgtaaccgaagccttcgtcgaggtctccagggag
atgatcagaatcggagagatgacttggagcaaggtgatagccctttacgcggtcgctggc
ggaatcggcgtggactgcgtgcgtcaggggaaacctgaatatttgccggcaattcagaga
ggtatgaccgatgtcttggaagaggaccttgcgacgtggatacaagctaacggaggatgg
ccagctttggtgacacgatacagacccgcgacgaacgagacgacgtggtattcaagtaga
ctcgtaccgttatttatacttattaccttgatcatttttgtgatctcgatatttttaaaa
cttttagtgttgtaa

DBGET integrated database retrieval system