KEGG   Ceratina calcarata (carpenter bee): 108625873Help
Entry
108625873         CDS       T06061                                 

Definition
(RefSeq) glutamyl aminopeptidase-like isoform X1
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
ccal  Ceratina calcarata (carpenter bee)
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccal01002]
    108625873
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccal04147]
    108625873
   04090 CD molecules [BR:ccal04090]
    108625873
Enzymes [BR:ccal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     108625873
Peptidases and inhibitors [BR:ccal01002]
 Metallo peptidases
  Family M1
   108625873
Exosome [BR:ccal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108625873
CD molecules [BR:ccal04090]
 Proteins
  108625873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Peptidase_M30 WLM
Motif
Other DBs
NCBI-GeneID: 108625873
NCBI-ProteinID: XP_017881692
LinkDB All DBs
Position
Unknown
AA seq 916 aa AA seqDB search
MTVCRFILIAIILTKDSRATYDDVSENKTTTRNSKSIVPEKRLPPDVIPKKYVIVICPDL
KEELFHGSVRIDLELLQDRSFIPLHTKDLDVSSVKLYARKSGTEVNLHSVFYVSRREMLV
VEPDRNLTIGEYFLKLNFTGSLRGKISGFYLSTYTDNNRSTRKLAVTQFEPLYARTAFPC
FDEPGFKSIFIVRIVYAKKFLYHAQSNMPVAKVETMKDDSSKTIAYFDPSPPMSTYLVAF
LVSDFECLGSEVKLLNKSKIPITVCVRPMYKHKVAFALNFTVKAMKFYLKTFQIDYPLPK
LDLVAIPDFTAGAMENWGLITFRETELLYSEGDSSCLNMRSVSLTVAHELAHMWFGNLVT
MKWWNDLWLNEGFATYMEHMAVDSLFSHWNLMDSFPLYTKYIAMKHDVKLRARPVVKRIE
NPEEIEEMFDRISYQKAAAVIRMLEDAVDNTNFISAVRNYLQSYQFRNAESRELFEILGN
STQSAIDMVDFVDRWMRFPGFPVINVVYDKTGYRLSQKRFATSERFIETIDDGSWTIPIR
YVTSRMEGVKLDWFLANFSCVELPLEKSVDWIKLNHNSAGYYIVNYTEDAWNTFNSLLLH
DHRALSAANRADLLHDAFLLAETDLSYSIVMNLTSYLANENAYQPWAVAAEWFGQMNRLL
AGRNVHANFQSYARDLVDKLYRQMGWRVHTKDPFSLREFRVLILNAACSVGHVHCLETAR
KKLRNHLSRRKEQKLHADVRSIVYSYGFVLLSNDTDSVYEHMSRLYKEQTDAQEKERLLT
GMTGLQDKDALNRYLERAMDESFVRKQDFSGVLIKIASNPAGLDVAWDFVRDRWEALLVK
YEANEFALGRIVCAIISLFKDRQRLQEARQFFLRELDLKITENAKRNSIEEIENSINWLE
ANTWTIEQWLASNGFD
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtttgtcggtttatcttaattgcaataatcttaacgaaggactcgcgcgcgacc
tacgacgacgtttccgagaataaaacaactacgcgcaacagtaagtccatagtacccgag
aaacgactccctcctgacgtgattcccaaaaagtacgtgatcgtgatttgccccgatctc
aaagaggaactgttccatggcagcgttcgcatcgatttagaattgttacaagacagaagc
tttatacctctgcacacgaaagacctggacgtatcatcggtgaaattgtacgcgagaaaa
tcgggaacagaagttaatttgcactctgtgttttacgtgagcaggcgtgaaatgttggtg
gttgaacccgataggaatctcacgataggggaatactttttgaaactgaattttactggt
agtttaagaggaaagataagcggattctatctgagcacttacacggataataatagatct
accaggaaactagcagtaacgcagttcgagccgttatacgccagaaccgcgtttccttgc
ttcgacgagccaggctttaaatcgattttcattgtccgcattgtctacgcgaaaaaattt
ctctatcatgctcaatccaacatgccagtcgcaaaagtagagactatgaaagatgacagt
agcaaaactatagcgtactttgacccctcgccaccgatgtccacgtatctcgttgccttc
ctcgtcagcgactttgagtgcttaggctccgaagtgaaactgctgaacaaaagcaaaatt
cccatcactgtctgcgtgaggccgatgtacaaacacaaagtggcgttcgctctgaatttt
acggtgaaagcaatgaagttttatttgaagacctttcagatcgattatcctctaccgaaa
ttagatctggttgctatacctgatttcacggctggcgctatggagaactggggcctaatc
acgtttcgcgagaccgagcttctctacagcgagggggacagttcttgcttgaacatgagg
agcgtcagcttgacggtggcccacgaactggcgcacatgtggttcggcaatctggtcacc
atgaagtggtggaacgatctctggctaaacgaagggttcgctacctacatggagcatatg
gctgtagactccttgttctcccactggaatctgatggattcgtttcctttgtacacgaaa
tacattgcaatgaaacacgacgtgaagcttcgcgcacgtccagtcgtgaagcgaatcgag
aatcctgaagagatagaagagatgttcgaccggatttcttatcagaaggcagcggcggtg
atcaggatgctcgaggacgcggttgacaatacgaacttcatttctgcagtaagaaactac
ttgcagagttaccagtttcgcaacgcggagtctcgcgagctgttcgagattctgggtaac
agtacacaaagtgcgatcgatatggtagacttcgtcgaccgatggatgagattccctgga
tttccagtgatcaacgtcgtctatgataaaaccggatatcgactgtcccagaaacgattc
gctactagcgagcgattcatcgagacgatcgatgatggaagctggacgattcctataaga
tacgtaaccagcaggatggagggtgtcaagctggactggttcctcgctaatttctcttgc
gtggaattgccgttggagaaatcagtggactggatcaaattgaatcacaactctgcgggc
tactatatcgtaaattacacggaagacgcgtggaacacgttcaacagtttgctactccac
gatcatcgagccttgagcgcggcgaacagggccgacttgttgcacgacgcgtttctttta
gcggaaactgatctaagctattctatagttatgaacttgacctcgtatctggcgaacgag
aacgcttatcaaccgtgggcggtagccgcggaatggttcggtcagatgaacaggctttta
gctggcagaaacgtacacgccaatttccagtcatatgcgagggatctcgtcgacaaatta
tatcgtcaaatgggatggcgcgttcatacgaaggaccccttcagtctcagagaatttcgc
gtattgatattgaacgcggcttgcagcgtgggccacgtgcactgtctcgagacagcaaga
aaaaagctgaggaaccacctttcccggcgtaaagagcaaaagttgcacgccgacgttcgc
tctatcgtctattcgtacggcttcgttctgttgtcgaacgacactgattccgtgtacgag
cacatgtcgcgattgtataaggaacagacggacgctcaggagaaagagaggctgttgacc
gggatgactgggctacaggataaagacgctcttaatcgatatttggaacgggcgatggac
gaaagttttgttcggaagcaggacttttcaggagtgctgatcaaaatcgcctcgaatccc
gcggggttggacgtcgcttgggatttcgtacgagatcggtgggaagctctgctagttaaa
tacgaggcgaacgagtttgctttgggaagaatcgtttgcgcgattatatcgctgtttaaa
gatcggcaacgattgcaagaagcgaggcaattcttcctgagagaattagatctgaaaata
accgagaacgcgaagaggaacagcatcgaagaaatagagaacagtataaattggctggag
gcaaacacgtggactatcgagcaatggctcgcgagcaacggtttcgattaa

DBGET integrated database retrieval system