KEGG   Ceratina calcarata (carpenter bee): 108626049
Entry
108626049         CDS       T06061                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal00230  Purine metabolism
ccal01100  Metabolic pathways
ccal04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108626049
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108626049
Enzymes [BR:ccal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108626049
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258 DUF1053
Other DBs
NCBI-GeneID: 108626049
NCBI-ProteinID: XP_026670452
LinkDB
Position
Unknown
AA seq 903 aa
MLRRQETSNEDSYLSAGRPSNLLRTRFSSTKLESLYRASSLQQRRGGLEYFLFSALLYGA
HTLAMPGQEPPACGLTAVCLGMNLGLLAWAERNPKAKDVLWSVIPHVAWKLSSVHLIAQL
FLKSNGVTPRDGLGWLLLLLYLLFATLPLRLSLCVLLAFCTAVAYIVSVIFLSKTPEKIP
IDVLVLTVTLCLGAMLLGASSYCLTEFQQRRAFLETRQSLEVQLVIEEQSAEQERLLLSV
LPEHVAVKMRQDLGASLNTQFKKIYMSRHENVSILYADIVGFTAISSTYSASELVKILNE
LFARFDQLSERLVDRRVHISNVTLGFLNGEFEVEPAHGEDREEALQKAGIITYFIVRALK
PFKPSVTWSLASLTEAENRRSLEANEEENTEDTEEFRQRLRKELDSKSGESHLEGHAYWL
TLQFKDKKVEFAFRNAEEAFSPLSLIGGPLVMMCASPVWRFQPWGPFTWGGIGVVVLFAI
VLAGATCLGSAIKAMWLRRALAVLMIFSLGDFLILDMYNCVVIEETIPPLNASNVPLSTR
CPHPSYYSYIGVLTLIALSLPTYMCYLGKACIMYFIAGTQCLINMWRLKARLDWEDYASS
PPEPKVPSTYCLSSTLLIVATCLVFVSRYAEKSRRMLYLRGREVVAQRERAADMKRRNGA
LIYNILPPHVAAYFLSRARHHDDLYSQSYAEVGVLFASMPNFADFYSEESINNQGLECLR
FLNEVISDFDAILDQHKFKDIIKIKTIGSTYMAASGITETLDSEESPRWCHLCILVDFAL
ELKKALSSINEQSFNHFVLKMGINQGPVTAGVIGARKPHYDIWGNTVNVASRMESTGKVG
CIQVTDETRRILEPFGFGFEQRGLVFVKGKGQLLTHYLVSKDGVSLNLDSDLPVEPTHPI
IYQ
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgttacggagacaagagacctcgaacgaggattcgtacctgagcgcggggaggccatcg
aacctgctgcgtacgagatttagcagcactaagctagagtcgctctatcgcgcctcctcc
ctccagcagcgccggggcggcctcgagtacttcctgttctcggcgttgctctatggagct
cacaccctcgcaatgccgggccaggagccgcctgcctgcggtctgacggcggtctgccta
ggcatgaatctgggcctgttggcctgggccgagcgcaaccccaaggcgaaggacgtactc
tggtccgtgatacctcacgtggcctggaagctgtcctctgtacacctcatcgctcagctg
ttcctcaagtccaacggggtcacgcctagggacggactgggctggctgctcctcctgctc
tacctcctgttcgccaccctgccgctcaggttgtccctctgcgtgctactcgccttctgc
accgcggtggcatacatcgtctccgttatcttcctctccaagacgcctgagaaaatacct
atcgatgttttggtgctgacggtgacgttgtgcctaggcgcgatgcttctgggagcctcg
agctattgcttgacagagttccagcaacggcgagcctttttggagaccaggcagagcctc
gaggttcaactggtgatcgaggagcagagtgccgagcaggagaggcttctgctcagcgtg
ttgccagaacacgtggccgtgaagatgcggcaagacctaggcgcctcgctcaacactcaa
ttcaagaagatctacatgtctaggcacgagaacgtatccatactctacgcggacatcgtc
gggttcaccgcaatttcatccacttacagtgccagtgaattggtgaaaattctgaatgag
ctgttcgcgagattcgatcagctcagcgagaggttagtggataggagggtgcatatctcg
aacgtgacgctgggctttctgaacggcgagttcgaggtcgagccggcgcacggcgaggac
agagaggaggcgttgcaaaaggctggcatcatcacctacttcatagtacgtgcattgaaa
cccttcaagccatccgtcacctggagcctggcgtcgctcacagaggcggagaataggaga
tctttggaagcgaacgaggaagagaacacggaagataccgaggaattccggcagaggttg
agaaaggaactggacagcaaaagtggggaatcgcacctggaagggcacgcttactggctg
acgctgcaattcaaagacaagaaggtagaattcgcgtttcgtaacgccgaggaagcattc
tctccgttgtcattgatcggtggaccattggtgatgatgtgcgcctcgccagtttggagg
tttcaaccctgggggccgtttacttggggcggtataggagttgtcgtgttgttcgccata
gtcctggctggtgccacttgcttgggcagtgctattaaagccatgtggttgaggcgagct
ctggctgtgttgatgatcttctccctcggggatttcctcattcttgacatgtacaattgt
gtggtgattgaggagacgataccaccactgaacgcgtccaacgtgcccctgtcgacgagg
tgcccgcacccgtcgtactactcgtacatcggcgtgttgacgttaatcgcgctctcgttg
ccgacctacatgtgctatctgggaaaggcttgcataatgtacttcatcgccggtactcag
tgtctcatcaacatgtggcgtctgaaagcgaggctcgactgggaggactacgcctcctcg
cccccggagccgaaagttccgtcgacatactgcctatcctccacactgcttatcgtcgcc
acctgtttggtcttcgtctccagatacgcggagaagtcgaggaggatgttgtacctccgc
ggtagggaggtggtagcgcagagggaaagggcggcagacatgaagcgcaggaatggcgcg
cttatatacaacattctaccgccgcacgtggccgcttacttcctctccagggcgagacac
cacgacgatctctacagccagagctacgcggaggtcggcgtactcttcgcgagcatgccc
aacttcgccgatttttatagcgaggagagcatcaacaatcagggcctcgagtgtctcagg
ttcctcaatgaagttatatccgatttcgacgcgatccttgatcagcacaagttcaaagac
atcataaaaatcaagacgataggctcgacgtatatggcagcgtctggtattacggagact
ttggactctgaggaatcgccccggtggtgtcacttgtgtattctcgtcgatttcgcgttg
gagttgaaaaaagcattgtcaagtatcaacgagcagagtttcaatcacttcgtcctgaag
atgggcatcaatcaagggccggtcacagctggtgtgatcggtgctaggaagcctcattac
gacatttgggggaacactgtgaacgtcgcgtccaggatggagagcaccggcaaagttggc
tgcattcaggtgacggacgagacgcgaaggattttggagccgttcggcttcgggtttgag
caacgcggtttggtatttgtgaaggggaaaggtcagttacttacccactacctggtgtcg
aaggacggcgtgtcgttaaacctcgacagcgacctgcccgtcgagcccacccatccgatc
atctatcaatag

DBGET integrated database retrieval system