KEGG   Ceratina calcarata (carpenter bee): 108631666Help
Entry
108631666         CDS       T06061                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal00040  Pentose and glucuronate interconversions
ccal00051  Fructose and mannose metabolism
ccal01100  Metabolic pathways
Module
ccal_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    108631666
   00051 Fructose and mannose metabolism
    108631666
Enzymes [BR:ccal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     108631666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_16 Pyr_redox_2 2-Hacid_dh_C Sacchrp_dh_NADP ThiF
Motif
Other DBs
NCBI-GeneID: 108631666
NCBI-ProteinID: XP_017891255
LinkDB All DBs
Position
Unknown
AA seq 348 aa AA seqDB search
MAKDNLTAIQYGINDIRLEQTPIEEPNENEVLLQMGCVGICGSDVHYMVHGRIGDFVVRQ
PMIIGHESSGVVAKLGKNVTNLKVGDRVAIEPGVPCRNCSFCKGGRYNLCKDVVFLATPP
VHGSLRRYYKHAADFCFKLPDHVTLEEGALLEPLSVGVHACKRANIGIGSKVLILGAGPI
GLVTLLVAKAMGASKILITDLEQDRLNLAKELGADYTLLVTRQDKEDENVRKIHQLLGEE
PDKTIDASGAQSSIRLAIFGTKSGGVAVMVGMGAPEVQIPLINALIREVDIRGVFRYAND
YADALDLVATGKVNVKPLVTHNYKIEETVQAFETAKAGQGVIKVMIHC
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggacaatctcacagccatccagtacggtatcaacgacatcagactggaacag
actcctatcgaagagcccaacgaaaatgaggtgctccttcagatgggttgcgtcgggatt
tgtggttccgacgttcactatatggtacatggaagaatcggtgacttcgtggtgcgacaa
cctatgataataggccacgagtcttctggtgtcgtcgccaaactcgggaagaacgtgact
aatttgaaggtgggcgacagagtggctatcgagcctggagtaccttgccggaattgcagc
ttttgtaaagggggacgatacaatctgtgcaaggacgttgtgttcttggccactcctccg
gttcacggcagcttgagacgttattacaaacacgctgctgatttttgcttcaagttacca
gaccatgtaactttggaagaaggagcgctgttggagccgttgtccgtcggagttcacgcc
tgcaagcgtgcgaacattggcattggatcgaaggtgttgatcttgggtgccgggccgatc
ggtctggtcaccttactggttgcaaaagctatgggtgccagcaaaattcttattactgat
ctggaacaggacagattgaacctggccaaggaattgggtgccgattatactttgttggtg
accaggcaagacaaggaggatgaaaatgtgcgcaagattcatcagcttcttggagaggag
cctgacaagacgatcgatgcttccggagctcagtcttcgattcgtctggcaatttttgga
accaaatccggcggagtggcagttatggttggaatgggcgcaccggaagttcagattcct
ctgatcaacgcgctcatcagggaagtcgacattcgaggagtgttccgatacgcaaacgat
tacgccgatgcgttggatctggttgcgacgggtaaggtaaatgtgaaaccactggtaact
cacaattacaagatcgaggagaccgtgcaagccttcgaaactgccaaagcgggacagggc
gtcatcaaggtgatgatccattgttag

DBGET integrated database retrieval system