KEGG   Ceratina calcarata (carpenter bee): 108632132
Entry
108632132         CDS       T06061                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal04013  MAPK signaling pathway - fly
ccal04214  Apoptosis - fly
ccal04215  Apoptosis - multiple species
ccal04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    108632132
   04391 Hippo signaling pathway - fly
    108632132
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108632132
   04215 Apoptosis - multiple species
    108632132
SSDB
Motif
Pfam: TNFR_c6 HCO3_cotransp Trp_oprn_chp
Other DBs
NCBI-GeneID: 108632132
NCBI-ProteinID: XP_017891966
LinkDB
Position
Unknown
AA seq 260 aa
MRGFSTWYTLLLPLFLHQIHSLTTPRHSLCEPGIEFWSQKHSSCYPCTKCQPEFTLSPCT
VYKDAICGPLSALELDWSFLSTGKRVETGERTMEAVTSKMLWRFPEFLDRNDDRLQSDKQ
IGVIREKLIWDWQTVALILAVCACILFFLVAGCSALLYARQWRRMKKNFEPVGLEEISAR
LNLMVKAELAELVSGTASTPDDPETRCQYLEKFLDGSRDSSLTIDWPEVTGNVYIEDGKP
RRTKKLQIARIQKEHRNDFN
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcgtgggttctccacttggtacactttactactaccattattcctccatcaaatccac
tcattaaccacacccagacactccttatgcgagccagggattgagttttggtcccaaaaa
cattcctcctgctatccgtgcaccaagtgccagccagagttcacgttgagcccttgtaca
gtctacaaggatgcaatttgtggccccttgtctgccctggagctcgactggtccttccta
tccactgggaaacgagtggagaccggggagaggaccatggaggcggtgacctccaagatg
ctctggaggttcccggaattcttagataggaacgacgataggcttcagagtgataaacag
atcggagttattcgagaaaagttgatatgggactggcagacagttgccttgatccttgcc
gtctgtgcctgcatcctcttcttcctggttgctggctgctcagccctgctgtacgcgaga
cagtggaggcgaatgaagaagaatttcgaaccagtgggactggaagagatctcggctcgg
ctgaacttaatggtaaaagcggaactggcagaactggtttcagggacggcatcgaccccc
gacgatcccgagaccaggtgccagtacctcgaaaagttcttagatggaagccgagactct
tcgctgacgatagattggccagaagtaaccggaaacgtttacatagaagacgggaagccg
aggagaacgaagaaactacaaatagcaaggatccaaaaggaacatcgaaacgattttaac
taa

DBGET integrated database retrieval system