KEGG   Ceratina calcarata (carpenter bee): 108633145Help
Entry
108633145         CDS       T06061                                 

Definition
(RefSeq) actin, clone 403-like
  KO
K05692  actin beta/gamma 1
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal04145  Phagosome
ccal04391  Hippo signaling pathway - fly
ccal04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    108633145
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108633145
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    108633145
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ccal03021]
    108633145
   03019 Messenger RNA biogenesis [BR:ccal03019]
    108633145
   03036 Chromosome and associated proteins [BR:ccal03036]
    108633145
   03029 Mitochondrial biogenesis [BR:ccal03029]
    108633145
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ccal04812]
    108633145
   04147 Exosome [BR:ccal04147]
    108633145
Transcription machinery [BR:ccal03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     108633145
Messenger RNA biogenesis [BR:ccal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     108633145
Chromosome and associated proteins [BR:ccal03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     108633145
    NuA4 complex
     108633145
  Chromatin remodeling factors
   BAF complex
    108633145
   PBAF complex
    108633145
   SWR1 complex
    108633145
Mitochondrial biogenesis [BR:ccal03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    108633145
Cytoskeleton proteins [BR:ccal04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     108633145
Exosome [BR:ccal04147]
 Exosomal proteins
  Proteins found in most exosomes
   108633145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin GerD
Motif
Other DBs
NCBI-GeneID: 108633145
NCBI-ProteinID: XP_017893662
LinkDB All DBs
Position
Unknown
AA seq 376 aa AA seqDB search
MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRYQGIMVGMGQKDSYVGDEAQ
SKRGVLTVKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRMD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFQQEMATAAGSSALEKS
YELPDGQVITIGNERFRCPEAMFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANSVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYDESGPSIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacgacgacgtagcggctttggtagtagacaatgggtcagggatgtgtaaggca
ggatttgcaggagatgatgctccgcgtgctgtattcccttccattgttggaagacctcga
taccagggaatcatggttggtatgggacaaaaggatagttacgtgggagatgaggcacag
agcaaaagaggagttttaactgttaaatatccgatcgaacacgggatagtaacgaattgg
gacgatatggaaaagatatggcatcacacgttctataacgaactgagaatcgctccggaa
gaacatcccgttcttctgaccgaagcccccttgaaccctaaagcgaatcgggaaaagatg
acgcagatcatgttcgaaacttttaattccccggcgatgtacgtcgctatacaagctgtt
ctgtcgctttatgcctccggacgaaccactggtatcgtcttagacagcggtgacggagtt
tcgcatacggtaccaatttacgagggatacgctttgccgcacgcaatattgcgtatggat
ctagcgggacgcgatctgacagattatctaatgaagattttaaccgagagaggatattcg
tttaccacgaccgcggagcgtgaaatcgttcgggacattaaggaaaaactgtgttacgtc
gcgctggactttcagcaggagatggcaacagccgctggctcgagcgccttggaaaagagc
tatgaattaccggacggtcaggtgatcaccatcggtaacgaacgtttccgatgcccggaa
gcgatgttccagccgagcttcctcggcatggaatcctgcgggatacacgagacgacctac
aattcgatcatgaagtgcgacgtcgacatacgcaaggatttatacgcgaattcggttctg
tcgggcggcaccactatgtatccggggatcgcagacaggatgcagaaggaaataacggca
ctggccccgtccacgatgaagatcaagataatcgctccgccggagaggaagtactcggtc
tggatcggtggctcgatcttggccagcttgagtaccttccagcagatgtggatctcgaag
caagagtacgacgaatcgggcccctccattgttcacagaaagtgcttctaa

DBGET integrated database retrieval system