KEGG   Ceratina calcarata (carpenter bee): 113463797Help
Entry
113463797         CDS       T06061                                 

Definition
(RefSeq) trifunctional enzyme subunit beta, mitochondrial
  KO
K07509  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal00062  Fatty acid elongation
ccal00071  Fatty acid degradation
ccal00280  Valine, leucine and isoleucine degradation
ccal01100  Metabolic pathways
ccal01212  Fatty acid metabolism
Module
ccal_M00085  Fatty acid elongation in mitochondria
ccal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    113463797
   00071 Fatty acid degradation
    113463797
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113463797
Enzymes [BR:ccal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     113463797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 113463797
NCBI-ProteinID: XP_017877917
LinkDB All DBs
Position
Unknown
AA seq 466 aa AA seqDB search
MLSLAKHTFLLKEGFAKYGFAINTLGVTNSYATKSNNAAKNIVFVDGVRTPFLQSGTTYK
NLMAYDLARHSLVALQRKIKFPKEIVEYIVYGTVIQELRVSNIAREAALAAGYSDRTPAH
TVTMACISSNQALTTGMGLIACGVYDVIIAGGVEFMSDIPIRHSRRMRSLMLQANKAKTV
GQKLSLLASVRPGHFVPDLPAVAEFSTNETMGHSSDRLAAAFGITRKEQDEYALRSHTLA
ANAQRQGYLSDLIPYKVPNVDQLVDKDNGIRVSTLEQLGKLKPAFVKPYGGVTAANASFL
SDGASAALIMTEEKALQLGLVPKAYLRNFTYVSQDPADQLLLGPAYAIPQVLQKAKLNLK
DIGVWEIHEAFAGQILANLKALDSNWFAQTYMGKSTKVGTPDLSKWNAWGGSLSIGHPFA
ATGVRLATHTANRMIREDQQFGLIAACAAGGQAVGMIMERYPGAKV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgctttctcttgcgaaacatactttcttactgaaagaaggattcgctaagtacggtttt
gcaataaacaccttgggagtaactaattcgtatgcaacgaagagtaacaatgctgctaaa
aatattgtatttgtcgatggtgtaaggacacctttcttgcaatccgggacgacttacaaa
aatctgatggcctacgatctagccagacactcgctggtggccttgcaaaggaagatcaaa
ttcccgaaagaaatcgtggaatacatcgtatatggcacggtaatacaggaattacgcgtg
tctaatatcgctagagaagcagctttagcagcaggatacagtgaccgcactcctgcgcat
actgtaacgatggcatgcattagtagcaatcaggctctcacaacaggcatgggattgata
gcttgtggcgtgtacgacgtaatcatagctggaggagtcgaattcatgtcggatataccg
atcagacatagcagacgtatgagatcgttgatgttacaagctaacaaagcaaaaacggtt
gggcagaaattatcactcctcgcgagtgtcagaccagggcatttcgtaccggacttacct
gcagtagcagagttttctactaacgaaaccatgggacatagcagcgacagattagcagct
gcgttcggaataacgagaaaggaacaggatgaatacgctttacgttcccatacactagcc
gctaacgcgcagaggcaaggatatctttcagacttgattccctacaaagttccgaacgtc
gaccagttagtggataaggacaatggtattcgggtttcaacgctcgagcaactaggaaaa
ttgaaaccagcatttgttaaaccgtatggaggagttacagctgccaatgcttccttttta
tccgatggggcatcggcagctttgataatgacggaagaaaaggctttgcaactcggactt
gtaccgaaagcgtatctgagaaatttcacttacgtctcccaagatcctgcggatcagtta
ctcttgggcccagcctatgctataccacaggtattacaaaaagcaaaattgaatctgaag
gacattggagtttgggaaattcacgaggcatttgctggacaaattttagccaacttgaaa
gcactagattcgaactggttcgcacaaacttacatgggtaaatctaccaaagtgggaaca
ccggatcttagtaaatggaatgcttggggaggatctttgtcgattggtcatccgttcgcg
gctactggagttcgtttagctactcataccgccaatcgaatgattagagaagaccagcaa
ttcgggctaattgcggcatgtgcagctgggggacaggctgtaggcatgattatggaaaga
tatcctggagccaaggtgtga

DBGET integrated database retrieval system