KEGG   Castor canadensis (American beaver): 109676510Help
Entry
109676510         CDS       T04791                                 

Definition
(RefSeq) anionic trypsin-2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04080  Neuroactive ligand-receptor interaction
ccan04972  Pancreatic secretion
ccan04974  Protein digestion and absorption
ccan05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109676510
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    109676510
   04974 Protein digestion and absorption
    109676510
 Human Diseases
  Infectious diseases
   05164 Influenza A
    109676510
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109676510
Peptidases [BR:ccan01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109676510
Exosome [BR:ccan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109676510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 109676510
NCBI-ProteinID: XP_020008472
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MRAFLILALVGSAAALPLDDDDKIVGGYTCSEYSVPYQVSLNSGYHFCGGSLINAQWVVS
AAHCYKYRIQVRLGEHDINVVEGNEQFITASKAIRHPKYSSWTLDNDIMLIKLSSPASLN
SQVAPVALPSSCAPAGTLCLISGWGNTLSSGVYNPDKLQCLDAPVLSQADCEASYPGEIT
NNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQPGSPGVYTRVCNYVDWIQ
ETIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattcctgatcctggcccttgtgggaagtgctgctgccctccctcttgatgat
gatgacaagattgttggaggatacacctgttcagaatattctgtcccctaccaagtgtcc
ctgaactctggctatcacttctgcggtggctccctcatcaatgcccagtgggtggtgtcc
gcagctcactgctacaagtaccgcatccaagtcagactgggagaacatgacataaatgtt
gttgagggaaatgagcagtttatcactgcttccaaggccatccgacaccccaagtacagc
tcatggactctggacaatgacattatgctgatcaagctctcctcacctgcatcccttaac
tctcaggtggcccctgtagctctgcccagctcctgtgcacctgctggcactttgtgcctc
atctcaggctggggcaacaccctcagctctggtgtttataacccagacaagttgcagtgt
ctagatgcccctgtgctaagtcaagccgactgtgaagcttcttaccctggagagatcact
aacaacatggtctgtgttggcttcctcgagggaggcaaggattcctgccagggtgactct
ggtggccctgtggtctgcaatggagagctccagggaattgtttcctggggctatggctgt
gctcagccaggtagtcctggagtttacacaagggtgtgcaactacgtagactggattcag
gaaaccattgctgccaactaa

DBGET integrated database retrieval system