KEGG   Castor canadensis (American beaver): 109677735Help
Entry
109677735         CDS       T04791                                 

Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00052  Galactose metabolism
ccan00500  Starch and sucrose metabolism
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109677735
   00500 Starch and sucrose metabolism
    109677735
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109677735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 109677735
NCBI-ProteinID: XP_020009157
LinkDB All DBs
Position
Unknown
AA seq 525 aa AA seqDB search
ITNKNEEKSSADTSQENPEDPGLWEEKFGNFVDVKANGPASIGLDFSLHGFEHVYGIPQH
AESHQLQNTRDGDAYRLYNLDIYGYQIHDKMGIYGSVPYLLAHKLGRTIGIFWLNASETL
VEINTEPAVEYTLTQMNPAAAKQMVRPRTNVHWMSESGIIDVFLLTGPTPSDIFKQYSYL
TGTQAMPPLFSLGYHQCRWNYEDEQDVEAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWD
KKKFPNPKRMQELLRSKKRKLVVISDPHIKVDPDYSVYAKAKEEGFFVRNKEGGDFEGVC
WPGLSSYLDLTNPKVREWYSGLFAFPAYQGSTDILFIWNDMNEPSVFRGPELTMQKNAIH
HGNWEHRELHNIYGFYQQMATAEGLIQRSKGKERPFVLSRSFFAGSQKYGAVWTGDNTAE
WSYLKISIPMLLTLNITGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMNTK
RREPWLFGEENTRLIREAIRERYTLLPYFYSLFYYAHVASEPVMR
NT seq 1579 nt NT seq  +upstreamnt  +downstreamnt
aatcaccaacaaaaatgaagagaagtcatcagctgacacctctcaggaaaatccagagga
tccaggcctgtgggaggagaaatttggaaattttgtagatgtcaaagctaatggtcctgc
atccattggtttggatttctccttgcatgggtttgaacacgtctatgggatcccacaaca
tgcagaatcacaccaacttcaaaataccagggatggagatgcttatcgtctttataacct
ggacatctatggatatcaaatacatgacaaaatgggcatttatggctcagtgccttatct
cctggcccacaaactgggcaggactataggcattttctggctgaatgcctcagaaacact
tgtggagatcaatacagaacctgcagtagagtacacactgacccagatgaacccagctgc
tgctaaacaaatggtcagacctcgaaccaatgtgcactggatgtcagaaagtgggatcat
tgatgttttcctgctgacaggacctacaccttctgacatcttcaagcagtattcatacct
tacaggcacacaagccatgccccctctcttctccctggggtatcaccagtgccgctggaa
ctatgaagatgagcaggatgtagaggcagtggatgccggatttgatgagcatgacattcc
ttatgatgtcatgtggctagacatagagcacactgagggcaagaggtacttcacctggga
caagaaaaaattcccaaaccccaaaaggatgcaagaactactcagaagcaaaaaacgtaa
gcttgtggtcatcagtgacccccacatcaaggttgatcctgactactcagtgtatgctaa
ggccaaagaagagggcttctttgtgaggaacaaagaagggggtgactttgaaggagtctg
ctggcccggtctctcctcttacctggatctcaccaatcccaaggtcagagagtggtattc
aggtctttttgctttccctgcttaccagggatcaacagatattctcttcatctggaatga
catgaatgagccctcagtctttagagggccagagctaaccatgcaaaagaatgccattca
tcatggcaactgggaacacagagaactgcacaacatctatggtttttatcagcaaatggc
tactgcagaagggctgatacaacgatctaaagggaaggagagaccctttgttctttcacg
ttctttctttgccggatcacaaaagtatggtgcagtgtggacaggcgacaacacagcaga
atggagttacctgaaaatttctataccaatgttacttactctcaacattactgggatctc
tttttgtggagctgatgtgggcggcttcattgggaatccagaggcagagctattagtgcg
ttggtaccaggcaggagcctatcagcccttcttccgtggccatgccaccatgaataccaa
gcggcgggaaccctggctgtttggggaggagaacaccaggctcatccgagaagctattag
agaacgctacaccctcctgccctatttttattctctgttctactacgcacatgtggcttc
tgaacctgtcatgaggtaa

DBGET integrated database retrieval system