KEGG   Castor canadensis (American beaver): 109680409Help
Entry
109680409         CDS       T04791                                 

Gene name
Cacna1e
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04010  MAPK signaling pathway
ccan04020  Calcium signaling pathway
ccan04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109680409 (Cacna1e)
   04020 Calcium signaling pathway
    109680409 (Cacna1e)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109680409 (Cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccan04040]
    109680409 (Cacna1e)
Ion channels [BR:ccan04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109680409 (Cacna1e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 109680409
NCBI-ProteinID: XP_020010854
LinkDB All DBs
Position
Unknown
AA seq 2313 aa AA seqDB search
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEVPPMNPLNPLNPLSPLNPLNAHPSLYRRARPIEGLALGL
GLEKCEEERISRGGSLKGDGGDLTSALDDQRSPMSLGKREPPWLTRPCHGNCDTTQQEAG
GGETVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSVSQERSLDEVVATEGEEEH
EPRSSHGGKEPTIHEEERVQDLRRTNSLMVPRGSGLAGALDEADTPLVLPHPEVEVGKVA
ALTEQEPEGSSEQALLGDVQLDVGRGISQSEPDLSCITANTDKATTESTSVTVAIPDVGP
LVDSTVVHISNKTDGEASPLKEAEIKEEEEEVEKKKKKEKRESGKAMVPHSSMFIFSTTN
PIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFE
MVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVL
RVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTD
SSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQH
SVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLE
KNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYY
SAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILT
DSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFI
YAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEP
DTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHH
LDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAED
MTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKA
SDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKSLPY
LQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQSSN
HGIYLPSDTQEHAGSGRASSMPRLTMDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSME
RSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRC
NSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRSRRQLP
PVPPKPRPLLSYSSLIRHVGSISPPADGSEGGSPLTSQALESNNAYLTESSNSPHPQQGQ
HSSPQHYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPN
GHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 6942 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggcccgggtcgggcgatggagactcggac
cagagcaggaaccggcaaggaaccccagtgccggcctcagggccggcggctgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcctgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcagaaaa
tacgccaagaaactcatcgattggccgccctttgagtacatgatcctggccaccatcatt
gccaactgcatcgtcttggccttggagcagcatcttcctgaggatgacaagactccgatg
tcccgaagactggagaagacagagccgtatttcattgggatcttctgctttgaagctggg
atcaaaatcgtggctctgggcttcatcttccataagggctcatacctccgcaatggctgg
aatgtcatggacttcattgtggtcctcagcggcatcctggccactgcaggaacccacttc
aacacccatgtggacctgaggaccctccgggctgtgcgtgtgttgaggcccttgaagctc
gtgtcaggaatacctagcctgcagattgtgttgaagtccatcatgaaggccatggtgcct
cttctgcagatcgggcttctgctcttctttgccatcctgatgttcgccatcattggcttg
gagttctacagtggaaagttacatcgagcatgcttcatgaacaattcaggtattctcgag
ggatttgaccccccacacccatgcggtgtgcagggctgcccagcgggttatgaatgcaaa
gactggattggccccaatgatgggataacccagtttgataacatcctttttgctgtgctg
actgtcttccagtgcatcaccatggaagggtggaccactgtgttgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaacctagtcctgggagtgctttctggggaatttgccaaagagagagagcga
gtggagaaccgaagagcattcatgaaactgcgacggcagcagcagatcgagcgtgagctg
aatggctaccgtgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaataaa
aatgctggaacatcagccttagaagtgcttcgaagggcaaccatcaaaaggagccggacg
gaggccatgactcgagactccagcgatgagcactgcgttgatatctcttctgtgggcaca
cctcttgcccgagccagtatcaagagtacgaaggtagatggggcctcctacttccggcat
aaagaaaggcttctgcgcatctctatccgccacatggtcaaatcccaggtgttttactgg
atcgtcttgagccttgtggctctcaatactgcctgcgtggccattgtccatcacaaccag
ccccagtggctcactcacctcctctactatgcagaatttttgtttctgggcctcttcctc
ttggagatgtccctgaagatgtatggcatggggcctcgcctttattttcactcttcattc
aactgctttgattttggggtcacagtgggcagtatctttgaagtggtctgggcaatcttc
agacctggtacatcttttggaatcagtgtcttgcgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatctctccggaatttggtggtctccttaatgagttccatg
aagtctattatcagtttgctcttcctcctcttcctcttcattgttgtcttcgctcttcta
ggaatgcagctgtttgggggcaggtttaactttaatgatgggactccttcagcaaatttt
gataccttccctgcagccatcatgaccgtgttccagatcctgactggggaggactggaat
gaagtaatgtacaatgggatccgctcccagggcggggtcagctcgggcatgtggtcagcc
atctacttcattgtgctcacgttgtttggaaactacacgctactgaatgtattcttggcc
attgctgtggacaatctggccaatgcccaggaactaaccaaggatgaacaggaggaagag
gaggccttcaaccagaagcatgcactgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttctatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagagagaggagacgccgacaccacatgtccgtgtgggaacag
cgcaccagccagctgagaaggcacatgcagatgtccagccaggaggcccttaacaaagag
gaggtcccaccaatgaaccccctcaaccccctcaacccactgagccccctcaacccactc
aatgctcaccccagcctctatcggagggccagacccattgagggcctggccctgggcctg
ggcctggagaagtgcgaggaagagcgtatcagccgtgggggatccctcaagggagatgga
ggtgacttgaccagtgccctggacgaccagaggagccccatgtccctgggcaaacgggag
ccaccatggctgactaggccttgtcatggaaactgtgacacaacccagcaggaggctggg
ggaggagagactgtggtgacctttgaggaccgggccaggcacaggcagagccagcggcga
agccggcaccgccgagtcaggactgaaggcaaggagtcctcctcagcctctcggagcagg
tctgtcagccaggagcggagtctggatgaagtggtagccactgagggggaggaggaacat
gagccccgaagcagtcatgggggcaaggaaccaaccatccatgaagaggagagagtgcaa
gacttaaggaggactaacagtctgatggtgcccagaggctctgggctggcaggagccctg
gatgaggctgacacaccccttgtcctgccccatcctgaggtggaagtgggaaaggttgca
gcactgacagagcaggagccagaaggcagcagtgagcaagccctgctgggggacgtgcag
ctggatgtgggccggggcatcagccagagcgagcctgacctctcctgtatcacagccaac
actgacaaggccaccactgagagcaccagtgtcactgttgctatccctgatgtggggccc
ttggtggattcaacggtggtgcacattagtaacaagactgatggagaagccagtcccttg
aaggaggcagagatcaaagaagaggaggaggaagtggagaaaaagaagaagaaggagaag
cgtgagagtggcaaagccatggtgccccatagctccatgttcatcttcagcaccaccaat
ccgatccgcagagcctgccactacatcgtgaacctgcgctactttgagatgtgcatcctc
ctggtgatcgcagccagcagcatcgccctggcagctgaggaccctgtcctgactaactca
gagcgcaacaaagtcctgaggtattttgactatgttttcacgggtgtgttcacctttgag
atggttataaagatgatagaccagggcttgatcctgcaggatgggtcctacttccgagac
ctctggaacatcctggactttgtggtggtggttggtgcattggtggcctttgctcttgcg
aacgctttgggcaccaacaaggggcgggatatcaagaccatcaagtcactgcgggtgctc
cgagttctcaggccactgaagaccatcaagcgcttgcccaagctcaaggctgtgtttgac
tgtgtggtgacctccttgaagaatgtcttcaacatactcattgtctacaagctcttcatg
ttcatctttgctgtcatcgcagttcagctgttcaagggaaagttcttttactgcacagac
agttccaaggacacagagaaggagtgcataggcaactatgtagaccatgagaaaaacaag
atggaggtgaagggccgagaatggaagcgccatgaattccattatgacaacatcatctgg
gcgttgctcaccctcttcacagtctccactggggaaggatggcctcaggttctacagcat
tctgtagatgtgacagaggaggaccgaggcccaagccgcagcaaccgcatggagatgtcc
atcttttacgtcgtctactttgtggttttccctttcttctttgtcaatatctttgtggct
cttatcatcatcacctttcaagagcaaggggacaagatgatggaggagtgcagcctggag
aagaatgagagggcgtgcatcgactttgccatcagtgccaaacctctcacccgctacatg
ccacagaacaggcacaccttccagtatcgtgtgtggcactttgtggtgtctccatccttt
gagtataccatcatggccatgattgccttgaacactgtcgtgctgatgatgaagtactac
tctgctccctgtacctatgaactggctctaaagtacctgaatatcgccttcactatggtg
ttttccctggaatgtgtcctaaaggtcatcgcatttggcttcttgaactatttccgagac
acctggaatatctttgacttcatcaccgtaattggcagcatcacagaaattatcctgaca
gacagcaagctggtgaacaccagtggcttcaatatgagctttctgaaactcttccgagct
gcccgcctcataaagcttctgcgacagggctacaccatacgtattttactctggaccttt
gtgcagtccttcaaggccctcccctatgtctgccttctgattgccatgctcttcttcatt
tatgccatcattgggatgcaggtatttggaaacatcaaattagatgaggagagtcacatc
aaccgacacaacaacttccggagtttctttgggtccctcatgctactcttcaggagtgcc
acaggtgaggcctggcaggaaattatgctttcatgccttggggagaaaggctgtgagccc
gataccacggcaccatcaggacagaatgagaatgagcgctgtggcaccgatctggcctat
gtttactttgtctccttcatcttcttctgctccttcctgatgctcaacctgtttgtggct
gtcatcatggacaactttgagtacctgactcgggactcttccatcctggggcctcaccac
ttggatgagtttgttcgcgtctgggcagaatatgacagagcagcatgtggccgcatccat
tacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagaga
tgtccctccaaagtggcatataagaggttggtcctgatgaatatgccagtagctgaggac
atgacagtccacttcacctccacacttatggctctgatccggacagctttggacattaaa
attgccaaaggtggtgcagacaggcagcagctagactcagagctccaaaaggagacgctg
gccatctggcctcatctgtcccagaagatgctggatctacttgtgcccatgcccaaagcc
tctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactattataaacag
agtaaggtgaagaagcaaaggcagcagctggaagaacagaaaaatgcacccatgtttcag
cggatggagccctcatcgctgcctcaagagatcattgctaatgcaaaatccctgccttat
ctccagcaggaccctgtttcaggcctgagtggccggagtggatacccttcaatgagtcca
ctctccccccaggagatattccagttggcttgtatggaccctgctgatgatggacaattc
caggaacagcaatctctggagccagaggttagtgaattaaaaagcgtgcagtcctctaac
catggcatctaccttccttcggacacccaggagcatgcgggatctgggagggcatcctct
atgccacgtctgactatggatccccaggtggtgacagaccctagctccatgagacgttca
ttttctactattcgggataagcgttcaaattcctcatggttagaggagttctccatggag
cgaagcagcgaaaacacctacaagtcacgtcgcaggagttaccactcctccctgcggctg
tcagcccaccgcctgaactctgattcaggccacaagtctgacacccaccgctcagggggc
agggagcgaggacgatcgaaagagcgaaagcatcttctctctcctgatgtctcccgctgc
aattctgaggagcgagggacccaggctgactgggagtccccagagcgccgccagtccagg
tcacccagcgagggcaggtcacagactcccaacagacagggcacaggttccctgagtgag
agctccatcccctccatctctgacaccagcaccccaagacgaagtcgtcggcagctccca
cctgtcccaccaaagcctcggcctctgctctcctacagctccctgattcgacatgttggc
agcatctctccaccagctgatggaagtgagggcggatcccccctaacctcccaagccctg
gagagcaacaatgcttacctgaccgagtcttccaactccccacacccccagcagggccag
cactcttctccacagcactacatctctgagccctacctggctctgcacgaagactcccac
gcctcagactgtggcgaggaggagacactcacctttgaagcagctgtggccactagcctg
ggccgttccaacaccattggctcagccccgcccctgaggcacagctggcagatgcccaat
gggcactatcggcgacggaggcgtggggggcccgggcccggcatgatgtgtggagctgtc
agtgacctcctgagtgacacggaagaagatgacaagtgctag

DBGET integrated database retrieval system