KEGG   Castor canadensis (American beaver): 109681522
Entry
109681522         CDS       T04791                                 

Gene name
Tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04010  MAPK signaling pathway
ccan04060  Cytokine-cytokine receptor interaction
ccan04068  FoxO signaling pathway
ccan04144  Endocytosis
ccan04218  Cellular senescence
ccan04350  TGF-beta signaling pathway
ccan04380  Osteoclast differentiation
ccan04390  Hippo signaling pathway
ccan04520  Adherens junction
ccan04659  Th17 cell differentiation
ccan04926  Relaxin signaling pathway
ccan04933  AGE-RAGE signaling pathway in diabetic complications
ccan05142  Chagas disease
ccan05161  Hepatitis B
ccan05166  Human T-cell leukemia virus 1 infection
ccan05200  Pathways in cancer
ccan05202  Transcriptional misregulation in cancer
ccan05210  Colorectal cancer
ccan05212  Pancreatic cancer
ccan05220  Chronic myeloid leukemia
ccan05225  Hepatocellular carcinoma
ccan05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109681522 (Tgfbr2)
   04350 TGF-beta signaling pathway
    109681522 (Tgfbr2)
   04390 Hippo signaling pathway
    109681522 (Tgfbr2)
   04068 FoxO signaling pathway
    109681522 (Tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109681522 (Tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109681522 (Tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    109681522 (Tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109681522 (Tgfbr2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109681522 (Tgfbr2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    109681522 (Tgfbr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109681522 (Tgfbr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109681522 (Tgfbr2)
   05202 Transcriptional misregulation in cancer
    109681522 (Tgfbr2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109681522 (Tgfbr2)
   05212 Pancreatic cancer
    109681522 (Tgfbr2)
   05225 Hepatocellular carcinoma
    109681522 (Tgfbr2)
   05226 Gastric cancer
    109681522 (Tgfbr2)
   05220 Chronic myeloid leukemia
    109681522 (Tgfbr2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109681522 (Tgfbr2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109681522 (Tgfbr2)
   05161 Hepatitis B
    109681522 (Tgfbr2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109681522 (Tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109681522 (Tgfbr2)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109681522 (Tgfbr2)
Protein kinases [BR:ccan01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   109681522 (Tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 109681522
NCBI-ProteinID: XP_020011911
LinkDB
Position
Unknown
AA seq 501 aa
MFPTKPGKEQCLSTSSLPGSSCILNPTLSLCFISTSEYTTSSPDLLLVIIQVTGVSLLPP
LGIAIAVIVTFYCYRVHRQQKLSPSWESSKPGKLMDFSEHCAIILEDDRSDISSTCANNI
NHNTELLPIELDILVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFS
DINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLA
WGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLAN
SGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGVNNDMLASDN
SGAVKIPQLCKFCDVRSSTCDNQKSCMSNCSITSICEKPHEVCVAVWRKNDENITLETVC
HDPKLPYHGFILEDVTSPKCIMKEKKVPGETLFICACSAEECNDHIIFSEGEFSSESLGQ
ISCQFPTSLVAIPQRMSSWGQ
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgttccccacgaaacctggaaaggagcaatgcttgagcacaagctcactgcctggaagt
tcatgcatcctgaacccaaccctttctctttgttttatctccacatcagaatataccacc
agcagtcctgacttgttgttagtcataatccaagtgacaggcgtcagcctcctaccacca
ctagggatcgccatagctgtcatcgtcaccttctactgctaccgtgttcaccggcagcag
aagctgagtccatcctgggaaagcagcaagcctgggaagctcatggacttcagtgagcac
tgtgccatcatcctggaagatgaccgctctgatatcagctccacatgcgccaacaacatc
aaccacaacactgagctgctgcctatcgagctggacatcctggtggggaaggggcgcttc
gcagaggtctacaaggccaagttgaaacagaacacgtcagagcagtttgagaccgtggcc
gtcaagatcttcccctatgaggagtatgcctcctggaaaacagagaaggatatcttctcg
gacatcaacctaaagcatgagaacattctccagttcctgacagctgaggagcggaagaca
gagctagggaaacagtactggctcatcactgctttccatgccaagggtaacctccaggag
tacctcacacggcacgtcatcagctgggaggatctgcgcaagctgggcagctccctggcc
tggggcattgctcacctccacagtgaccacactccgtgtgggaggcccaagatgcccatc
gtgcacagggacctcaagagctccaatatccttgtgaagaacgaccttacctgctgcctt
tgtgactttgggctgtccctgcgtctggaccctactctgtctgtagatgacctggctaac
agtgggcaggtgggaactgcaagatacatggccccagaagttctagaatccaggatgaat
ttggagaatgttgagtccttcaagcagactgacgtgtactccatggctctggtgctctgg
gaaatgacatctcgctgtaatgcagtgggagttaataatgacatgctggccagtgacaac
agtggtgcggtcaagattccacaactgtgtaaattttgtgacgtgagatcttccacctgt
gacaaccagaagtcctgcatgagcaactgcagcatcacgtccatctgcgagaagccacac
gaagtctgtgtggccgtgtggaggaagaatgatgagaacataacactagagacggtttgt
cacgaccccaagctcccttaccatggatttattctggaagatgttacttctccaaagtgt
attatgaaggaaaaaaaagtgcctggtgagaccttatttatatgtgcctgtagtgctgaa
gagtgcaatgaccacatcatcttctcagaaggtgagttttcttctgagagtctggggcag
atatcctgtcagttccctacatccctggttgcaatcccacagagaatgtcctcctggggc
cagtga

DBGET integrated database retrieval system