KEGG   Castor canadensis (American beaver): 109681579Help
Entry
109681579         CDS       T04791                                 

Gene name
Caskin2
Definition
(RefSeq) caskin-2 isoform X1
  KO
K21952  CASK-interacting protein
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccan04131]
    109681579 (Caskin2)
Membrane trafficking [BR:ccan04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    109681579 (Caskin2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 SAM_1 Ank_4 Ank Caskin-Pro-rich Ank_3 SAM_2 Caskin-tail SH3_2 Caskin1-CID SH3_9 SH3_1
Motif
Other DBs
NCBI-GeneID: 109681579
NCBI-ProteinID: XP_020011987
LinkDB All DBs
Position
Unknown
AA seq 1226 aa AA seqDB search
MGREQDLIVAVKNGDVTCVQKLVAKVKASKTKLLGSTKRLNVNYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAAVNTASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRVGYFPPGIVEVVSKRVGIPVPRLPSAS
TPLRPGFSRTPQLPVDDPLHSLTYGQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHSTGLLIENAQPLPSAGEDQVLPRLHAPPLADNLGHRPLASHRSGEIFTQDVR
PEQLLEGKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKK
IASEIAQLSISEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEI
GVNKLGHQKKLMLGVKRLAELRRSLLQGEALGEGGCRLARGPELMAIEGLENGEGPAVAG
PRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGSGHSQEQPAPQPSG
GEPITPQERNLPEGTERPSKLCSPLSGQGPAPYVFMCPQGSPSSPAPGPPPGAPRAFSYL
AGPLATPPDPPRPKRRSHSLSRPGPAEGEAEGEAEGPMGSALGSYATLTRRPGRSALART
SPSPTPTRGTSRSQSFALRARRKGPPPPPPKRLSSVSGPTEPLPLDGSPGPKEGATGPRR
RTLSEPSGPLEPPGPPTPAGPASDTEEEDPVSEGTPPSRGSSGEGLPFAEEGNLTIKQRP
KPAGPPPRETPVPLGLDFNLTESDTVKRRPKCREREPLQTALLAFGMAGATPSSSAPLPS
QAPSEASSSASSSPLRPEPSSLANQGSLAPLTPATQSPVPCAGPSLEHSASRQNVETEHL
AAPTALLKVPGAGRKQCLWEGGTVCWVVSSPAKSQANLFVSTGTGPKPVSVACTQLAFSG
PKLAPRLGPRPVPPPRPENTGAMGPGRAQQRLEQTSSSLAAALRAAEKSIGAEEQEGPSG
TSTKHILDDISTMFDALADQLDAMLD
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgagaacaggaccttatcgttgctgtcaagaatggagatgtgacctgtgtccag
aaactggtggccaaggtcaaggcttcaaagacaaagctccttggcagcacgaagagactc
aatgtcaactaccaggatgctgatggattctctgctctccaccatgccgccttgggaggt
agcctggagctcatagccttactgctggaggctcaggccaccgttgacatcaaagacagc
aatggtatgcgtccactgcactacgcagcctggcagggccggttggagcctgtgaggctg
ctgctgcgggcctctgcggctgtcaacactgcctcactggacgggcagatccctctgcac
ctggccgcacagtacggacactatgaggtgtcagaaatgctcctccagcatcagtccaac
ccatgcctagtcaacaaggccaagaagacacctctggacctggcctgtgaattcgggcgg
ctcaaggtggcccagctgctactgaacagccacttatgtgtggcgttactggaaggtgag
gccaaggacccatgtgaccccaactacactacgccactgcatttggctgctaagaatggc
cacagagaagtcatcaggcaactcctgagagctgggattgagatcaaccgtcagaccaag
acaggcacggcgctccatgaggctgcattatatggcaagaccgaggtggtgcggctgctc
ctggagggaggcgtagacgtgaacatccggaacacatataaccagactgcactggacatt
gtgaaccaattcaccacctcccaggccagccgggagatcaagcagctacttcgggaagct
tcggggatcctgaaggtccgagcgctcaaggatttctggaacctccatgatcccactgct
ctcaatgtccgagcaggggatgtcatcacggtgcttgaacagcatccagatggccgctgg
aagggccacatccatgagagccaaagaggcacagaccgcgtgggctacttcccaccaggc
atcgtggaggtggtcagcaagcgggtgggcatccctgtgccccgtcttccctctgcgtcc
acccccttgcgcccaggcttctcccggacaccacagcttcctgtcgatgaccccctgcac
tctcttacctatggccagctccctcgggtgggcctcagcccagacagcccagcaggtgac
aggaatagcgtgggcagtgagggcagtgtgggcagcatccgcagtgctggcagcgggcag
agttccgagggcaccaatggccacagcactggcctccttattgagaatgcccagccgctg
ccctctgccggagaggaccaggtgctgccaagactgcacgccccacctctggcagacaac
ctgggccaccgccctctggccagccaccgctctggggagatcttcacccaggatgtgagg
cctgagcagctgctggaagggaaggatgcacaggccattcataactggctgagcgaattc
cagctggagggctacactgcccattttcttcaggctggctatgacgtgccaaccatcagt
cgcatgacgcctgaggatttgacagccattggagtgaccaagcctgggcacaggaagaag
atcgcttcagagattgcccagctcagcatctccgaatggctgcccagttacatcccgacg
gacctgctggagtggctgtgtgcactcgggctgccacagtatcacaagcagctggtgagc
agcggctatgactctatggggctggtggccgatctcacctgggaggagctgcaggagata
ggtgtcaacaagctggggcaccagaagaagcttatgctgggtgtgaagcggttggcagag
cttcggcggagcctgctacaaggagaggccctaggcgaaggcgggtgccggctggccagg
ggtccagagctgatggccattgaggggctggagaatggggagggtccagccgtggctggc
ccacgcctcctcacctttcagggtagtgagctgagcccagagctacaggcagcaatggca
gggggtggccctgaaccgcttcccctgccccctgcccgttcccccagccaggagagcatt
ggagcacgctcacggggatctggtcactcacaagaacagcctgccccccagcccagtggt
ggagagcccatcactccacaggagaggaaccttccagagggcacagagcgcccttccaag
ctttgctccccactttctggccaaggacctgccccttatgtttttatgtgcccccagggc
tcaccctccagcccagccccagggccacctcctggtgcaccccgggccttctcctacttg
gctggccctcttgccactcccccagacccacctcggcccaaacgccggtcccacagcctg
agccgccctggccctgctgaaggagaagctgaaggggaggctgaagggccaatgggcagt
gccttgggcagttatgctaccctcactcggcgaccaggacgcagtgcccttgctcggacc
agtcctagcccaaccccaactcgagggacctcccgcagccagtcctttgccctccgggcc
cgtcgtaagggcccccctccgccaccccccaagcgcctcagctcagtttctggccctaca
gagccactgccactagatgggagcccagggcccaaggagggggcaacagggccccgaagg
agaacactgagtgaaccaagtgggcccttagagccccctggcccacccaccccagctggc
ccagcatctgacacagaagaggaggatcctgtctctgagggaacacccccatctcggggc
agctcaggggaagggctgccatttgcagaggaggggaacctgactatcaagcagcggccg
aaaccagctggccccccaccccgggagacccccgtgcccctgggcctcgacttcaacctc
acagagtcagacactgtcaagcggaggcccaaatgcagggagagagagccactacagaca
gcactgttggcctttgggatggcaggtgccacccctagctcctctgcacccctgccttcc
caagcccccagcgaggcctcctcttcagcctcctccagccctttgcggcctgaacccagc
agccttgcaaatcaaggatctctagcccctcttacccctgcaacacagtccccagtgccc
tgtgctggcccaagtctggaacactcagcaagcaggcaaaatgtggagaccgaacacctg
gctgcccccactgccctcctcaaggtgcctggagcaggtagaaagcaatgcctgtgggaa
ggaggtactgtgtgctgggttgtgtccagcccagccaagtcacaagccaacctttttgtc
tctacaggaacaggccccaagcctgtgtctgtggcctgcactcagctggcattttctggc
ccaaagctggctccccggcttggcccccggccagtgccccctccaaggcctgagaacact
ggggctatgggcccaggtagggcccagcagagactggagcagaccagctcatccctggca
gctgcactgagggcagccgagaagagcattggcgctgaggaacaagagggcccctctggg
acctccaccaagcacattctggacgacatcagcaccatgtttgatgccctggctgaccag
ctggatgccatgctggattga

DBGET integrated database retrieval system