KEGG   Castor canadensis (American beaver): 109682405Help
Entry
109682405         CDS       T04791                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 4-like
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04371  Apelin signaling pathway
ccan05034  Alcoholism
ccan05165  Human papillomavirus infection
ccan05169  Epstein-Barr virus infection
ccan05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109682405
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    109682405
  09164 Substance dependence
   05034 Alcoholism
    109682405
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    109682405
   05165 Human papillomavirus infection
    109682405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccan03036]
    109682405
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109682405
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109682405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 109682405
NCBI-ProteinID: XP_020013196
LinkDB All DBs
Position
Unknown
AA seq 1085 aa AA seqDB search
MKQNRKYQFAPKKNGLSGRDQPVELLNPTRVNHMPSTVDVATALPLQVAPAAVPMDLRLD
HQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQ
QQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMK
LQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYD
AKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVADSACSS
APGSGPSSPNSSSGNVSTENGIAPTVPSIPAETSLAHRLVTREGSVAPLPLYTSPSLPNI
TLGLPATGPSAGAAGQQDAERLALPTLQQRISLFPGTHLTPYLSTSPLERDGGAAHNPLL
QHMVLLEQPPTQTPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPXPQNA
QALQHLVIQQQHQQFLEKHKQQFQQQQLHLSKIIPKPSEPARQPESHPEETEEELREHQA
LLDEPFLDRLPGQKEVHTLAGVQVKQEPIESDEEEAEPVREAEPGQRPPTEQELLFRQQA
LLLEQQRIHQLRNFQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTT
GLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTV
HSEAHTLLYGTNPLNRQKLDSSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVV
ELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLNVSKILIVDW
DVHHGNGTQQAFYSDPNVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLD
PPMGDTEYLAAFRMVVMPIANEFAPDMVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQ
LMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELEPLPEKVLQQRPNANAVRSMEK
VMEIHSKYWRCLQRLSSTVGHSLIEAQKCENEEAETVTAMASLSVGVKPAEKRPDEEPME
EEPPL
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaacaggaaataccaatttgcaccaaagaaaaatggactttctggacgagac
cagccagtagagctgctgaatcctacccgcgtgaaccacatgcccagcacagtggacgtg
gccacagcactgcctttgcaagtggcccctgcagcagtgcccatggacctgcgcctggat
caccagttctcgctgcctgtggcggagccagcgctgcgagagcagcagctgcagcaggag
cttctggcgctgaaacagaagcagcagatccagcggcagatcctcattgctgagttccag
cggcaacatgagcagctgtcacggcagcacgaggctcaactgcatgagcacatcaagcag
cagcaggagatgctggccatgaagcaccagcaggagctgctagagcaccagcgcaaactg
gagcggcaccgccaggagcaggagctggagaagcagcaccgtgagcagaagctacagcag
ctcaagaacaaggagaagggcaaagagagtgcagtggccagcacagaggtgaagatgaag
ctgcaggagtttgtcctcaacaagaagaaggcactggcccaccggaacctaaaccactgc
atttccagcgacccccgctactggtatgggaagacacagcacagctccctggaccagagc
tcgcctccccaaagtggggtgtcagcctcctataaccatccagttctggggatgtatgat
gccaaagatgacttccctcttaggaaaacagcttctgagcccaacctgaaattgcggtcc
aggcttaagcagaaagtggctgagagacggagtagccccctgttgcgcaggaaggatggg
cctgtggtcactgctctaaaaaagcgtcccctggatgttgcagactctgcatgcagcagc
gcaccaggctccggacccagctcacccaacagcagctccggcaatgtcagcaccgaaaat
ggcattgcgcccacagtgcccagcatcccagctgagaccagcttggcgcatagacttgtg
actcgagaaggctcagttgccccacttcctctctacacgtcaccatccttgcccaatatc
accttaggacttcctgccactggtccttctgctggtgcagcaggccagcaggatgccgaa
agacttgctctcccaaccctccagcaacggatctccctgttccctggcacccacctcacc
ccatacctgagcacctcgcccctagagcgggatggcggggcagctcacaacccactgttg
cagcacatggtccttctggaacagccacctacacagacacccctcgtcacaggcctgggg
gcactgcccctccacgcacagtcgttggtcggtgcagaccgtgtgtccccatccatccac
aagctgcggcagcatcgcccactgggccgcacacagtcagcacccntgccacagaatgca
caggccctgcagcacctggtcatccagcagcagcaccagcagttcctggagaagcacaag
cagcagttccagcagcagcagctacacctcagcaagattatccccaaacctagtgagcca
gcccggcagcctgagagccaccccgaagagacagaggaggagctccgtgagcaccaggcc
ctgctggacgagcccttcctggaccggctcccagggcagaaggaggttcatacacttgct
ggtgtccaggtgaagcaggagcccattgagagtgacgaggaggaggcagagcctgtgcga
gaagcagagccaggccagcgtccgcccacagagcaggaactgctcttcagacagcaagcc
ctcttgctggagcagcagcggatccaccagctgaggaacttccaggcatccatggaggct
gcgggcatccctgtgtcattcggtggccacaggcctctgtctcgggcacagtcatcccca
gcatccgccacgttccccatgtcggttcaggaaccccccaccaagccaaggttcaccaca
ggccttgtgtacgacacactgatgctgaagcaccagtgcacctgtgggaacaccaacagc
caccctgagcacgctgggagaatccagagcatctggtcccgcctgcaggagactggcctc
cgtggcaagtgcgagtgcatccgcggacggaaggccacgctggaggagctgcagacagta
cactcggaagctcacacactcctctatggcacaaaccccctcaataggcagaaactggac
agctcactgacttcggtgtttgtcaggcttccttgtggtggtgttggggtggacagcgac
accatatggaacgaggtgcactcatcaggggcagcccgcctagccgtgggctgcgtggtg
gagctggtctttaaggtggccacaggggagctgaagaatggctttgcagtggtccgcccc
ccaggacaccacgctgaggagagcacccccatggggttttgctacttcaattctgtggcg
gttgcagccaagcttctccagcagaggctgaacgtgagcaagattctcattgtggactgg
gatgtacatcatgggaatgggacccagcaggctttctacagtgaccccaatgtcctttac
atgtccctgcatcgctacgacgacgggaacttcttcccaggcagtggggcacctgatgag
gtgggcacaggtccaggcgtgggcttcaatgtcaacatggctttcacaggtggcctcgac
ccccccatgggagacactgagtacttggcagccttcagaatggtagtcatgccaatcgcc
aatgagtttgccccagacatggtgctggtgtcgtcaggctttgatgctgtggagggccac
cccacaccccttggagggtacaacctgtctgccaaatgttttgggtacctgacaaagcaa
ctgatgggcctggctggcggccggattgtgctggctcttgagggaggtcacgacctgaca
gccatctgtgatgcctccgaagcatgcgtttctgctctgctgggaaacgagcttgagcct
ctgccagaaaaggttttacagcaaagacccaatgccaatgctgtccgctccatggaaaaa
gtcatggaaatccacagcaagtactggcgctgcctgcagcgcttgtcctccacagtgggg
cattctctgatcgaggcgcagaagtgtgagaatgaggaagctgagacagtcaccgccatg
gcctcgctgtcagtgggcgtgaagcccgccgagaagaggccagacgaggagcccatggaa
gaagaaccaccactgtag

DBGET integrated database retrieval system